KEGG   Drosophila grimshawi: Dgri_GH14732Help
Entry
Dgri_GH14732      CDS       T01061                                 

Definition
GH14732 gene product from transcript GH14732-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dgr  Drosophila grimshawi
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dgri_GH14732
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dgri_GH14732
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dgri_GH14732
  Exosomal proteins of breast milk
   Dgri_GH14732
Heparan sulfate/heparin binding proteins [BR:dgr00536]
 Enzymes (General comment) Variety
  Dgri_GH14732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 333 aa AA seqDB search
MNIFTAFPLEVAINVIDTVCSSTMYIGSVPPQITPDITKMNFQYMTPCLNYTVPLLKAEK
LWNHPRFRKNRKLVILATGWTNTVNDSETIAMISKAFMCRPGVNFVIVDAAYYVDTLYKW
SAFNTDLIGEHLAVGLQHLVEVMPFIEIHLIGHSLGAHIMGKAGRSFERLTGHLVARITG
LDPAKPCFRYEKALPGLMRGDAKLVDIIHSNIGILAKRDPMGDIDFYPGGVHPIKPGCLS
IGCSHTRAVEYFAESVYPRQESSYLGWKCHSWKELEWRKCDTLTTSTMGYVINWKAKGIY
YVDVNGKSPFGKNPNSPKRGRLDCVKHRCKYKN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttttacagcatttccgcttgaagtagccataaatgttattgataccgtgtgc
tcatccacgatgtatattggaagcgttccaccgcaaataacgccagatataacgaagatg
aactttcagtacatgacgccatgtctgaactatactgtaccattgttgaaagccgaaaag
ctatggaatcatccaagattccgaaaaaatcgcaagttggttattctagcaactgggtgg
acaaacaccgttaacgattcagaaactatagcgatgatatcgaaggcttttatgtgccga
cctggtgttaactttgtgattgtggatgcagcctattatgtggacaccttgtacaagtgg
tcggctttcaatacggatttgattggtgagcacctggctgttgggttacagcacttggtc
gaggtgatgccgttcattgaaattcacttgatcggtcattctttgggtgcacatattatg
ggcaaagctggtcgctctttcgagcgactcacaggacatttggtggcacgtataacgggt
ctggatcctgccaagccctgtttccgctatgaaaaagcgctgcccggcctgatgcgtggc
gatgccaaattggtggacattatacattcaaatattggcatactggccaaacgtgatcca
atgggtgacattgacttttatccaggtggagtgcatcccataaagcccggttgcctgtcc
attggttgctcacacacacgtgccgttgaatattttgcggagagtgtttacccaagacag
gaaagcagctacttgggctggaaatgccattcatggaaggagctcgaatggcgaaaatgc
gacactctcacaacttccacaatgggttacgtgattaattggaaggccaagggtatctat
tatgttgatgtgaatggcaagagtccgtttggaaaaaaccccaattcacccaaacgaggc
cgccttgactgtgtcaagcataggtgtaaatacaagaattga

DBGET integrated database retrieval system