KEGG   Drosophila grimshawi: Dgri_GH14732Help
Entry
Dgri_GH14732      CDS       T01061                                 

Definition
(RefSeq) GH14732 gene product from transcript GH14732-RA
Organism
dgr  Drosophila grimshawi
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
AA seq 333 aa AA seqDB search
MNIFTAFPLEVAINVIDTVCSSTMYIGSVPPQITPDITKMNFQYMTPCLNYTVPLLKAEK
LWNHPRFRKNRKLVILATGWTNTVNDSETIAMISKAFMCRPGVNFVIVDAAYYVDTLYKW
SAFNTDLIGEHLAVGLQHLVEVMPFIEIHLIGHSLGAHIMGKAGRSFERLTGHLVARITG
LDPAKPCFRYEKALPGLMRGDAKLVDIIHSNIGILAKRDPMGDIDFYPGGVHPIKPGCLS
IGCSHTRAVEYFAESVYPRQESSYLGWKCHSWKELEWRKCDTLTTSTMGYVINWKAKGIY
YVDVNGKSPFGKNPNSPKRGRLDCVKHRCKYKN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttttacagcatttccgcttgaagtagccataaatgttattgataccgtgtgc
tcatccacgatgtatattggaagcgttccaccgcaaataacgccagatataacgaagatg
aactttcagtacatgacgccatgtctgaactatactgtaccattgttgaaagccgaaaag
ctatggaatcatccaagattccgaaaaaatcgcaagttggttattctagcaactgggtgg
acaaacaccgttaacgattcagaaactatagcgatgatatcgaaggcttttatgtgccga
cctggtgttaactttgtgattgtggatgcagcctattatgtggacaccttgtacaagtgg
tcggctttcaatacggatttgattggtgagcacctggctgttgggttacagcacttggtc
gaggtgatgccgttcattgaaattcacttgatcggtcattctttgggtgcacatattatg
ggcaaagctggtcgctctttcgagcgactcacaggacatttggtggcacgtataacgggt
ctggatcctgccaagccctgtttccgctatgaaaaagcgctgcccggcctgatgcgtggc
gatgccaaattggtggacattatacattcaaatattggcatactggccaaacgtgatcca
atgggtgacattgacttttatccaggtggagtgcatcccataaagcccggttgcctgtcc
attggttgctcacacacacgtgccgttgaatattttgcggagagtgtttacccaagacag
gaaagcagctacttgggctggaaatgccattcatggaaggagctcgaatggcgaaaatgc
gacactctcacaacttccacaatgggttacgtgattaattggaaggccaagggtatctat
tatgttgatgtgaatggcaagagtccgtttggaaaaaaccccaattcacccaaacgaggc
cgccttgactgtgtcaagcataggtgtaaatacaagaattga

DBGET integrated database retrieval system