KEGG   Drosophila grimshawi: Dgri_GH14799Help
Entry
Dgri_GH14799      CDS       T01061                                 

Definition
GH14799 gene product from transcript GH14799-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dgr  Drosophila grimshawi
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dgri_GH14799
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dgri_GH14799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 316 aa AA seqDB search
MARLIESNIVPIAVGVVAVVAGALIVHYLINKKSTKPRREPNRTARLRTLVDANDKYQLP
LVEKEVLSHDTRRFRFGLPSKQHILGLPVGQHIHLIATIDNELVIRPYTPISSDDDVGYV
DLVVKVYFKDTHPKFPAGGKMTQHLEQMEVGDKISFRGPSGRLQYLGNGTFSIKKLRKDP
PKQVTAKRVNMIAGGTGITPMLQLVREVLKHSDKDNTQLALLFANQSEKDILLRAELDEL
AKKHPDQFKVWYTVDKAAEGWKHSVGFINDEMIAAHLLPANDDTIVLLCGPPPMINFACN
PALDKLGYHPDTRFAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcctcatcgagagcaatattgttcccattgctgtgggcgttgtggctgtggtt
gccggcgcattgatagtccactatttgatcaacaagaaatcgacgaagccgcgccgtgaa
ccaaatcgaacggcacgtttgaggacgctcgtcgatgcgaatgacaagtatcagctgccg
ctggttgagaaggaggtgctcagccatgatacgagacgtttccgtttcggtttgccctcc
aagcagcatatactcggtttgcctgtcggccagcacattcatctgattgctaccatcgat
aatgagcttgtgatacggccgtatactccaatttcatcggacgatgatgttggctatgta
gacttggtggttaaggtgtactttaaggacacacatcccaaattccccgctggcggtaaa
atgacccagcatttggagcaaatggaggtgggcgataagatttcgttccgtggaccgtcg
ggtagattgcagtatttgggcaacggcaccttctccattaaaaagttgcgcaaggatccg
cccaaacaggtgaccgccaagcgtgtcaacatgattgccggcggcaccggaatcacaccc
atgttgcaactggtgcgtgaagttctcaagcacagcgacaaggacaacactcaactggca
ctgctctttgccaaccagagtgaaaaggatattttgctgcgcgccgaactggatgagctg
gccaagaaacatcccgaccagttcaaggtctggtacactgtggacaaagctgccgaaggt
tggaaacacagcgttggattcattaatgatgaaatgattgccgcccatctgctgccggcc
aacgatgatacgattgtgctactctgtggaccgccgcccatgatcaactttgcctgcaat
ccagcgttagacaagcttggctatcatccggacacacgttttgcgtattaa

DBGET integrated database retrieval system