KEGG   Drosophila grimshawi: Dgri_GH14861Help
Entry
Dgri_GH14861      CDS       T01061                                 

Definition
GH14861 gene product from transcript GH14861-RA
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dgr  Drosophila grimshawi
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dgri_GH14861
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dgri_GH14861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 216 aa AA seqDB search
MSAPVIVEATAKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIRAARDDVHTMIQKEVNAGIPANRIVLGGFSQGGALALY
SALTFAQPLAGVVALSCWLPLHKQFPGAKISSDEVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDEEMSDVKDIISKWVN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaccggtaattgtcgaggcaacggccaaacaaacagcaacgctcatcttcatg
cacggcttgggcgacactggccatggctggagcagtgctttggctgctatacgtccaccg
ttcatgaaggtgatttgtccgacggcaccaacacagcccgtctcgttgaatgccggcttt
cgcatgccgtcgtggttcgatttgaagaccctggatattggcgggccggaagatgagccg
ggcatacgtgcggcccgtgacgatgtgcacacaatgatacagaaggaggtgaacgccggc
ataccggccaatcgcattgtgctcggcggtttctcgcagggcggcgccttggctctctac
tcggctctgacctttgctcaaccgctggccggtgttgtggcactctcgtgttggctgcca
ctgcacaagcagttccccggcgccaagatcagcagcgatgaggtgcccatattccaagcg
cacggagattatgatcccgttgtgccttataaatttggccaactcagcgccagtctgctc
aagtcgttcatgaagaatgtcacctttaaaacgtacagcggactctcgcactcctcatcc
gatgaggagatgagcgatgtaaaggacataatcagtaaatgggtaaactaa

DBGET integrated database retrieval system