KEGG   Drosophila grimshawi: Dgri_GH14964Help
Entry
Dgri_GH14964      CDS       T01061                                 

Definition
GH14964 gene product from transcript GH14964-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dgr  Drosophila grimshawi
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dgri_GH14964
Enzymes [BR:dgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dgri_GH14964
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C44
   Dgri_GH14964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 565 aa AA seqDB search
MCGIFAIFSSDGKAIAARCIHGSKHTLRELAYRQSGRQRHRGPDSTGVVVVAEQGVAMVH
ERLRIVGVEMGDQPFVSDDGNLILVANGEIYNYLELAAQIAKRRGGYKPKSDCHVILELY
RDYGVDLLQHITGMYAFALYDKRTKELLLARDPIGIIPMYLGEDTAGNIWIASEMKCLVG
VCERVETFTPGEARFGRVGAMRRWRHFEQPWMQQLPTLACDLSLLRTSLESAVRTHLHCD
VHFAALLSGGVDSSLIASIATKIMRETNPDYKLKTFSVGLRNAPDFEAARQVAKYIESDH
TELIFEIEDALDGIRDIVYHLETYDVTTVRCSLPMLLLARYIKSTGIKMILSGEGADEIF
GGYLYFHKAPNYQEFHEELVKRVQQLHLSDCLRANKVAMAKGVELRVPFLDTAFVNYVMN
IRPQDKIPGELNTFTNEHKTRMEKYVLRAAFAEDYLPDEVLWRQKEQFSDGVGYAWIDSI
RRVATSHVGDEEFALAGERFPFNTPTTKEAFYYRCIFEQQFPGESAAKTVVRWVPRLDWG
CPEDPSGRAQAVHQNKEAETERERA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatttttgccattttttcaagcgatggcaaggccatcgcagccagatgcatt
cacggcagtaaacatacattgcgggaactggcctatcgccagagtggcaggcagcggcat
cgtggaccagactccactggcgttgtggtcgtcgccgagcagggagtggccatggtacac
gaacgcctacgtattgtgggcgtggagatgggcgatcaaccctttgtctccgacgatggc
aacttgatactcgtcgccaacggcgagatctacaattatctggaacttgcggcgcagatt
gccaagcgacgtggtggctacaaaccgaaaagcgattgccacgtgatacttgaattgtat
cgggattatggagtggatttgctgcagcatattacgggcatgtatgccttcgccctgtac
gacaagcgcaccaaggagctgctactcgcccgtgatcccattggtattatacccatgtat
ctgggcgaggatacagcgggcaacatttggattgcctcggagatgaagtgtttggtgggc
gtttgtgagcgagtggagacttttacgccgggagaggcgcgttttggacgcgtcggcgca
atgcgtcgctggcgccactttgagcagccatggatgcaacagttgcccactttggcctgc
gatttgtcgctgctccgcaccagtttggagtcagcggtgcgcacccatctccactgtgat
gtgcattttgctgcactgctctccggcggagtcgattccagcttgattgcctcgattgcc
acgaagattatgcgtgaaactaatcccgactacaaattgaaaaccttctcggtgggttta
cgcaatgcgccggattttgaggctgctcgccaggtggccaaatacatagagagtgaccac
acagagctgatttttgagattgaggatgcgctggatggcatacgggatattgtgtaccat
ctggagacctacgatgtgaccaccgtgcgctgcagtctgccaatgctgctcctggcacgc
tacatcaagagcactgggattaagatgatactctccggcgagggtgccgatgagatcttt
gggggctatttatacttccacaaggcacccaactatcaagagttccacgaggagctggtg
aagcgtgtccagcaactgcatttatccgattgtctgcgtgccaacaaggtggccatggcg
aagggtgtagagttgcgtgttccattcctggacacggcattcgtcaactatgtgatgaac
atacggccacaggacaagattcccggtgaactgaacaccttcaccaatgagcacaaaaca
cgcatggagaagtatgtgttgcgtgccgcatttgccgaggattatctgccggatgaggtg
ttgtggaggcagaaagagcagttctccgatggcgtcggctacgcttggattgacagcata
cgccgtgtggctaccagtcatgtgggggacgaggagttcgcattggccggcgagagattc
cccttcaatacgcccacaacgaaggaggctttttattatcgctgcatttttgagcagcag
tttccgggcgagtcagcggcaaaaacggtggtcagatgggtgccacgcctcgattggggc
tgtccggaggatccgtcgggtagggcacaggcggtgcatcagaataaagaggcagagact
gagcgagaaagagcttaa

DBGET integrated database retrieval system