KEGG   Drosophila grimshawi: Dgri_GH14986Help
Entry
Dgri_GH14986      CDS       T01061                                 

Definition
GH14986 gene product from transcript GH14986-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dgr  Drosophila grimshawi
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dgri_GH14986
   04068 FoxO signaling pathway
    Dgri_GH14986
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dgri_GH14986
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dgri_GH14986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 546 aa AA seqDB search
MAAISGPKRHPLSNQHHFSHPTNSTTTTNNTPSHTTNIRNNNNNNNSSSSNNKLYSYKTP
ANPQHHQHQQNTAPSYCTTKIIKSSTANSINNTTTNAEKNKSNSCPNSSAAAPRSSMSVS
MSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDPRDGR
RVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELL
QSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICD
FGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQ
AQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVH
LLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQ
PFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASSTVAHPSELPP
SPHQWE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcggccattagtggccccaagcggcatccattgagcaatcaacaccatttctcccat
ccaactaacagcaccaccaccaccaacaatacacccagccacaccaccaacatccgcaat
aacaacaacaacaacaacagcagcagcagcaacaacaagctttatagctataaaacgcca
gctaatccccagcaccatcagcaccaacagaacacagcaccaagctactgcaccaccaaa
atcatcaaatcctccactgccaattccatcaacaacaccaccaccaacgctgagaagaac
aagagcaacagctgcccaaattcttcagctgctgcgccgcgtagctcgatgagcgtatcg
atgtcactggtacagggtggtgctgccggtggtgcgccacagggcgccagcgcaatacta
gcagctgcggctccatattatcaaccgccagcggtgccacaggatgttcaaccggatcgt
ccaattggctacggtgcattcggcgttgtctgggccgttacagatccgcgtgatggacgc
cgcgtcgcactgaaaaagctgccaaatgttttccaatcgttggtctcatccaagcgcgtt
ttccgtgaactgaaaatgctttgctttttcaagcatgagaacgtgctgtcagctttggac
attttacagccaccacatttggacttctttcaggaaatctatgtgataactgagctgctg
caatcggatctgcacaagatcattgtgtcgccacagcatctatccgcggatcacatcaaa
gtctttctataccagatactgcgtggattgaagtatctgcactcggcacggatattgcat
cgcgatatcaagcccggcaatctgctcgtcaactcgaattgtgtgctcaagatctgtgac
tttgggctggcgcgcgtcgaggagccggatcaggccaagcacatgacccaggaagtggtc
acacaatattatcgagcgcccgaaattttaatgggtgctcgccactattcatcggcggtg
gatgtgtggtcggtgggctgcatctttggtgagctgctcggccgacgtatattgttccag
gcgcagaatcccgtacagcagctggagctaatcaccgagctgctgggcacacccaccatg
gaggatatgcgtcatgcctgcgagggggcacgcacacacatgctgaggcgagcgccaaag
ccaccatccttctcggtgctgtacacgctcagctcacatgccacacacgaggcggtccat
ttgctctgccagatgcttgtctttgatccggataagcgcatttcagtgacggatgctttg
gcgcatccctatctggatgaaggccgtttgcgctatcattcgtgcatgtgcaaatgctgt
ttcactacctcagctggcatgcgtcagtatacggcggactttgagccatcggccggtcag
ccctttgatgatctatgggagcgcaaactcacctctgtgcagcaggtgaaggaggaaatg
cataaatttattgccgagcagctgcaaacgggtcgtgtgccgctctgcattaatccgcag
agtgcggcattcaagagctttgccagctcaactgtggcacatccttcggagctgccgcca
tcgccgcatcaatgggaatga

DBGET integrated database retrieval system