KEGG   Drosophila grimshawi: Dgri_GH15072Help
Entry
Dgri_GH15072      CDS       T01061                                 

Definition
GH15072 gene product from transcript GH15072-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH15072
Transcription machinery [BR:dgr03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dgri_GH15072
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 687 aa AA seqDB search
MKKGTEASAGEDKTAIALKFEQLAKDDLRQDTVHDFVSYTTDGNCITLIGSKTELLTMEL
TSKSSYQVPFPYILASAKCSNKKRPLDHLSLKVNLQNIYESSNVLEMQQLSLEPAYTAVC
SEEVPVPKIMAARLAPQRLPGGQMLLATLNSYGAVDLLTKSVEQTTWDHYGEGLSVATTL
RDTLQPPYEVPASKIETFRQFQAFIDRSWITMFAWRPVDGKYALVLGTAAGSIWTLTLSP
DAHTVLAHCQLQTLLDRICYMHSSKDLLLVGDNSGLVHLYRFDDAEEEGLCLVKTLWLRP
DHMGLQQALITHCPQRGCYYIVCCKAAHLLIWCMPRKENGEWLETRLHAGGMKITALCSL
ENGNYALATARGDLYRIELTHKSGQLSASMQPIELKDSENFQPVGLFSSPHNNLLTVLST
RNKEYVLNTTLLRYQLQVRVGRLQRVDAIAKLAGCLLPNEAINSCSDILVEMRLDIFNGI
KLEEYANYAPFDLFAFDELASESQHQHLQLKYHVLDGIIQAQRVQLNDQPLEQSKREMQL
LLAMLTMTHIRLRLQYLSSLDELTAFQRQAAQSMLAQSTRIKQQLEQQLLKDQPLNVTIK
RFLAQMEVHFEELQLKLNVPKITVEETEQLCNVSYVPLKPSLERHYCSLCGRQALLEHQL
LMELYAPNSQLLCPCCHGGYNLELWDA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtactgaggcaagcgctggcgaagacaaaactgctatagcgttgaaattc
gaacagttggccaaagatgatcttaggcaggatactgtgcacgacttcgtgtcctacaca
acggatggcaattgcattacgcttattggctccaaaacggagctgctcaccatggagcta
acgagcaagtcgtcatatcaagtgcccttcccctacattctggccagcgcgaagtgctcg
aacaaaaagcggccactggaccatctgtcgctgaaagtgaatctccagaatatctacgag
agcagcaatgtgctggagatgcagcagctgagcttggagccggcttacacggccgtctgt
tcggaggaagtgccagtgccaaagattatggccgccagattagcaccgcagcgtctgcct
ggcggccaaatgctgttggccacgctgaacagctacggagccgtggacttgttaactaag
agcgtggagcagacgacctgggatcactatggagaaggtcttagtgtggccactacactc
agggatacgttgcagcctccgtatgaagtgccagcatcaaagatcgaaacatttcgccaa
tttcaggcatttattgatcgcagctggataacaatgttcgcttggcgtccagtcgatggc
aaatatgcgctcgtcctgggcacagctgccggcagcatttggactctgaccttaagcccc
gacgcccacactgtgcttgctcattgccagctgcagacgcttttagatcgcatatgttac
atgcacagctctaaggatctgctcctggttggcgacaacagtggactcgtgcatctgtac
aggtttgatgacgccgaagaggagggcctctgtctggtgaaaacgctctggctccgaccc
gatcacatgggtttgcaacaggcattgattacgcattgtccgcaacgcggctgctactac
attgtctgctgcaaggcagcgcatctgctgatttggtgcatgccacggaaggagaatggt
gaatggcttgagacacgtctccatgcaggtggtatgaagatcactgcactttgcagtctg
gagaatgggaattatgctctggcaactgcgcgtggagacttatatcgaattgagctcacc
cataaatccggtcagctgagtgctagcatgcagccgattgagttgaaggattcagagaac
ttccaaccagttggcctgtttagcagtccgcacaacaatctactgactgtgctctcaacg
cgcaacaaggagtatgtactcaatacgactctgctgcgttatcaactacaggtgcgcgtg
ggcaggctgcaaagagtggatgccattgctaagcttgccggatgtctgttgcccaacgag
gccatcaacagctgcagcgatatattggtcgaaatgcgattggacatatttaacggtatc
aaactagaggagtacgcgaattatgcgccattcgatttgtttgccttcgatgagttggcc
tcggaatcgcagcatcagcatctccaactcaaataccatgttcttgatggaattattcag
gcacagcgagttcaacttaacgaccaaccgctggaacaatccaagcgcgaaatgcagctg
ctcctggccatgttaactatgactcacatacgactgcgtttgcaatacttgagcagcttg
gatgaactaacggcatttcagcggcaagcagcgcagtctatgctggcgcaaagtactcgc
atcaagcagcaactggagcagcagctgctaaaggatcagccactcaacgtgaccattaaa
cgttttctagcccagatggaggtgcactttgaagagctgcagcttaaattgaatgtgccc
aagattaccgttgaggaaactgagcagctatgcaacgtttcctatgtgccgctaaagcca
tcgctggagcgacactattgctcactatgcggtcgccaggcgctgctggagcatcagctg
ctaatggagctttatgccccgaatagccagctgctctgcccctgctgtcatggaggatac
aacttggagctgtgggatgcatag

DBGET integrated database retrieval system