KEGG   Drosophila grimshawi: Dgri_GH15376Help
Entry
Dgri_GH15376      CDS       T01061                                 

Definition
GH15376 gene product from transcript GH15376-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dgr  Drosophila grimshawi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dgr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 523 aa AA seqDB search
MRIFCLAFSIQFTFCYCQYFSGPDPTWNIRSKNEMKSKDFWFSDAQSTLYEKLSMQPNQY
QAKNIIFFLGDGMSVPTVTAGRIYDGQQRGIIGERNRLEFEKFPYVGLSKTYCVDKQVSD
SACTASAYLTGVKANYETIGVSADVKRNDCSGAKLPQNQLSSIAAWAMRGHKSTGLVTTT
RVTHASPAGVYAHTSNRDFESDFDVHDLGHDPNNCPDIAQQLLDEVGQGLRVVLGGGTKK
FLPNTMRDVYGNLGQRLDGRNLIEEWQRSKFGNARVVFNRTDLLRNDARYTDYLLGLFNT
SHLAYNLDDSIDTPSLEEMTEAAIEVLSQDPAGYFLFVEGGRIDHAHHETKAKKALDETV
QFSNAVRKARQLTNRWDTLIVVTADHGHTMTINGYADINNNITGFNSELSDVDNLPYATL
SYANGPNYKKFYKVSGNEVDRVDLRTLNIGHKKARYPHGVPMSEETHGGGDVAVYANGPW
AHLFSGVYEQNTIPHLMGFAACIGPGITYCNLRPNKTTSPIVD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcttttgcttagcgttctcaattcaatttactttctgctactgccaatacttt
tctgggccagatcccacatggaatattcgttccaaaaatgagatgaagagcaaggacttt
tggttttctgatgcccagagtacgctttacgaaaagctatccatgcagcccaatcaatat
caggccaagaatataatcttcttcctgggcgatggcatgtccgtgccgacagtgacagca
ggccgaatatacgacggtcaacaaagggggatcataggcgaacgcaatcgtctggagttt
gaaaagtttccctatgtggggttgtcaaagacctactgcgtcgataaacaagtgtcagac
tctgcctgcaccgcttccgcctacttaaccggtgtaaaggccaattatgagacaatcggt
gtatccgctgacgttaagcgtaatgattgcagcggagctaagctaccccaaaatcaacta
tcctccattgcagcctgggcaatgagaggccacaagtcgaccggtctggtgactacaacc
cgtgtaacccatgcgagtccagctggagtctatgcacacacctcgaatcgtgactttgaa
agcgatttcgatgtacatgatctgggccatgatccgaacaattgtccggacatcgcccag
caactattggacgaggtaggtcaaggcttgagggtagtgcttggtggaggtaccaagaaa
ttcttgcccaacacaatgagggatgtgtatggcaaccttggccaacgtttggatggacgt
aatctaattgaggagtggcaacgtagcaaatttggcaatgcacgtgttgtcttcaatcgc
acggatctgctgagaaatgacgcccgctatacggactacttgttgggtttgttcaatacc
tcgcatctggcatataatttggatgatagcattgatacgccatcgcttgaggagatgact
gaagcggcaattgaagtgttgtcgcaagatccagctgggtactttctgtttgtcgaaggc
ggtcgtatcgatcatgcccatcatgagaccaaagccaagaaggctttagacgaaacggtc
cagttctcaaatgctgttcgaaaagcgcgacagttaaccaatcgttgggacactctgatt
gttgtcactgccgatcacggacatactatgactattaacggatacgcggatataaacaac
aatataaccgggtttaactcagaactaagcgatgttgataacttaccctatgcaacatta
tcatacgccaacggaccgaattataaaaaattctataaggtatcggggaatgaggttgat
cgcgttgatctccgcactttgaatatcggtcataagaaagcaaggtatccacatggtgtg
cccatgtctgaggaaactcacggcggtggagacgttgccgtatacgctaatggaccttgg
gcacatttgttcagcggtgtttacgagcaaaacacaatcccgcatctaatgggatttgca
gcatgcataggccctggaattacttattgcaatctcagacccaataaaactaccagtcct
atcgtagattaa

DBGET integrated database retrieval system