KEGG   Drosophila grimshawi: Dgri_GH15498Help
Entry
Dgri_GH15498      CDS       T01061                                 

Definition
(RefSeq) GH15498 gene product from transcript GH15498-RA
  KO
K03259  translation initiation factor 4E
Organism
dgr  Drosophila grimshawi
Pathway
dgr03013  RNA transport
dgr04150  mTOR signaling pathway
Module
dgr_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dgri_GH15498
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dgri_GH15498
Messenger RNA biogenesis [BR:dgr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dgri_GH15498
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dgri_GH15498
Translation factors [BR:dgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dgri_GH15498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 6556563
NCBI-ProteinID: XP_001983586
FlyBase: FBgn0122970
UniProt: B4J209
AA seq 228 aa AA seqDB search
MGFDNYKGTEVAESGQETYTADKQFSAVDEELQPSLNSVLSSIDYELCEKHPLEHTWTLW
HWQSDRKKCWEEMLSNVTSFNTVEDFFSVHYFIKPPSDLKAFNDYMVFKHDIRPMWEDAK
NRKGGRWIFFLNRESKELVDNMWHDLLLCTLGESFEYPFQICGAVVNVRNKAAKISLWTK
DSLNQHAILAIGRKIKEVLQLCEGQLQYQVHSDAMIHTGPNCNALYKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgataattacaagggcaccgaggtagccgaatccggccaggagacttatacg
gctgacaagcaattctccgccgtcgacgaggaactgcaaccatcgctgaatagtgttttg
agttccatagactatgagctgtgcgagaagcatccgctggagcacacttggacactgtgg
cattggcagagcgatcgcaaaaagtgctgggaggaaatgcttagcaatgtgaccagtttc
aataccgtcgaagatttctttagtgttcactattttattaagccaccatcggatctaaag
gctttcaatgattatatggtcttcaaacatgacatacgacccatgtgggaggatgccaag
aatagaaaaggcggccgttggatttttttcttgaacagagagtccaaagagctggtggac
aatatgtggcatgatttgctgttgtgcacacttggcgagagctttgagtacccctttcaa
atctgtggcgctgtcgtcaatgtgcgcaacaaggccgccaaaatatcactgtggaccaag
gactcgctcaatcagcacgccattctggcaattggacgcaaaatcaaggaggtgctgcag
ctgtgcgagggacaattgcaatatcaggtgcactcggatgcaatgatccacactggaccc
aattgcaatgccttgtacaaattgtaa

DBGET integrated database retrieval system