KEGG   Drosophila grimshawi: Dgri_GH15498Help
Entry
Dgri_GH15498      CDS       T01061                                 

Definition
GH15498 gene product from transcript GH15498-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dgr03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dgr04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 228 aa AA seqDB search
MGFDNYKGTEVAESGQETYTADKQFSAVDEELQPSLNSVLSSIDYELCEKHPLEHTWTLW
HWQSDRKKCWEEMLSNVTSFNTVEDFFSVHYFIKPPSDLKAFNDYMVFKHDIRPMWEDAK
NRKGGRWIFFLNRESKELVDNMWHDLLLCTLGESFEYPFQICGAVVNVRNKAAKISLWTK
DSLNQHAILAIGRKIKEVLQLCEGQLQYQVHSDAMIHTGPNCNALYKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgataattacaagggcaccgaggtagccgaatccggccaggagacttatacg
gctgacaagcaattctccgccgtcgacgaggaactgcaaccatcgctgaatagtgttttg
agttccatagactatgagctgtgcgagaagcatccgctggagcacacttggacactgtgg
cattggcagagcgatcgcaaaaagtgctgggaggaaatgcttagcaatgtgaccagtttc
aataccgtcgaagatttctttagtgttcactattttattaagccaccatcggatctaaag
gctttcaatgattatatggtcttcaaacatgacatacgacccatgtgggaggatgccaag
aatagaaaaggcggccgttggatttttttcttgaacagagagtccaaagagctggtggac
aatatgtggcatgatttgctgttgtgcacacttggcgagagctttgagtacccctttcaa
atctgtggcgctgtcgtcaatgtgcgcaacaaggccgccaaaatatcactgtggaccaag
gactcgctcaatcagcacgccattctggcaattggacgcaaaatcaaggaggtgctgcag
ctgtgcgagggacaattgcaatatcaggtgcactcggatgcaatgatccacactggaccc
aattgcaatgccttgtacaaattgtaa

DBGET integrated database retrieval system