KEGG   Drosophila grimshawi: Dgri_GH15580Help
Entry
Dgri_GH15580      CDS       T01061                                 

Definition
GH15580 gene product from transcript GH15580-RA
Orthology
K13129  
survival motor neuron protein
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dgri_GH15580
Spliceosome [BR:dgr03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    Dgri_GH15580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 223 aa AA seqDB search
MSEDKNVWDDSLLIKAYDDSVNLARETLARRIADATNRREDNSKTAAESEPNQENVFQVG
DFARATYTDGLDYEATVLSIDEQTQKCVLRYVGYENEQEVPLSLLLPSWGNKARSEQILS
AKQAEGGEEHQQLEQEQQRAKTSKKSTGKGKQTNRGHLAGPSPGLVMPPMPLVPPMFTPG
GGIDGEPEQDFVAMLTAWYMSGYYTGLYQGRKESSAKKKTAKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggacaagaatgtttgggatgatagcctactgattaaggcatacgatgattct
gtaaatttggcccgtgaaacgctcgctcgtcgcatagccgatgcgaccaatcgacgcgag
gacaacagcaaaaccgcggcggaatcggaaccgaatcaggagaatgtgttccaagtcggc
gactttgccagggccacttacacagatggcctggactacgaggccactgtgctgtccatc
gatgagcagacacagaaatgcgtactgcgctacgtgggctatgagaatgaacaggaagtg
ccactctcgctcctgctgcccagctggggcaacaaagcgcgtagcgagcaaatcttaagc
gccaagcaagcagaaggcggagaggagcatcagcagctggagcaggagcaacaacgtgca
aagacctccaagaagtcgacgggcaaaggaaagcagacaaatcggggacatttggcaggt
ccttcgccgggtttggtgatgccaccaatgccactggtgccgccaatgtttacaccaggc
ggtggcatcgatggtgaaccagaacaggattttgttgccatgctcaccgcttggtacatg
tccgggtattatacgggactctatcagggcaggaaggagagcagtgccaagaagaagaca
gcaaagaaataa

DBGET integrated database retrieval system