KEGG   Drosophila grimshawi: Dgri_GH15657Help
Entry
Dgri_GH15657      CDS       T01061                                 

Definition
GH15657 gene product from transcript GH15657-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dgr  Drosophila grimshawi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH15657
   00052 Galactose metabolism
    Dgri_GH15657
Enzymes [BR:dgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dgri_GH15657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 364 aa AA seqDB search
MVKVTEDTFASGAVNPFTKQTEEIRRFTLSNDEQMSVQILTRGATISSIKVPDAQGQVED
VTLGFDNLAGYASEQNPYMGATVGRVCNRIANGRFVLDGKTIEVSRNRGEFQLHGGFIGF
DKAHWDVVELLPNGVKMSHTNPDGHEGYPGEVRATATFILTEDNCLHVRMDAVTSKPTPV
NLTNHSYFNLAGHKAGPNGIYEHTIQINAYGITETDANSIPTGKILPVDGGKFDLRVASN
LGDRLKELQPALGYDDNFCVKFTPPASIANIARITHPPSGRWLEIASNQPGVQFYTSNFL
PDKEGKRETPLAGKAGAAYIKHGAFCLETQKFPDSVNHENFPTSILRPGEKYHHEVIYKF
GKQH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaggtcacggaagatactttcgccagcggggcagtgaatccattcaccaagcaa
acggaggaaatacgacgcttcacgctgagcaacgatgagcaaatgtccgttcaaatattg
acgcgaggcgcaacaatcagcagcattaaagttccagatgctcaaggtcaagtggaggat
gtgacgctgggatttgataatctggcgggctacgccagcgaacagaatccgtatatgggt
gcaacggtgggcagggtttgcaatcgcatcgcaaatggcagatttgtcctggatggcaaa
acaattgaagtctcccgcaatcgaggagagtttcagctgcatggcggctttattggcttt
gataaggcacactgggacgtggtcgaactgctgccaaatggtgtcaaaatgtcgcacacc
aatcccgacggtcacgaaggctatccgggtgaggtgcgagcgacagccacgttcatcctt
actgaggacaattgcctgcatgtccgcatggatgctgtgacctcaaaaccaacgcccgtc
aatctcaccaatcactcgtactttaatctggccgggcacaaggcgggcccaaatggaatc
tacgagcacacgattcaaattaatgcctatggcattaccgaaacggatgcaaattcaata
cccaccggcaaaattctgcccgtagatggaggcaaatttgatttgcgtgtagccagcaac
ttgggtgatcggctcaaggaattgcagccagctcttggatacgatgacaatttctgtgta
aaattcactccgcccgcaagcattgcgaacattgcccggattacacatccgccaagcggt
cgctggctggagattgccagcaatcagcctggcgtccagttctatacgtccaacttcttg
cccgacaaggaggggaagcgtgagacaccgctggcaggcaaagcgggtgctgcttacatt
aaacatggcgcattctgtctggagacgcaaaagtttcctgactccgtgaatcatgagaat
ttccccacaagcattctgcgaccgggcgaaaagtatcatcacgaagttatctataagttt
ggtaagcagcactga

DBGET integrated database retrieval system