KEGG   Drosophila grimshawi: Dgri_GH15662Help
Entry
Dgri_GH15662      CDS       T01061                                 

Definition
GH15662 gene product from transcript GH15662-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dgr  Drosophila grimshawi
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dgr00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 536 aa AA seqDB search
MDSSGSEAGDASMAGPFVGAIDEGTTSARFMIFRAGTDDIVCYHQIEVPSIFVKEGWCEQ
DPCVITNTVNDCIEGACQKLVALGGKIENILAIGITNQRESTVVWDRHTGKALANAIIWL
DNRTTSTVEDLLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVASVKKAMDAGD
AMFGTIDTWLMYNLTGGPKGGVHKTDVTNASRTMLMNIETLQWDPALLKFFGLPASILPE
ICSSAEHFGTIAAGTLRGISIAADLGDQQAALVGQQCLAKGQAKATYGTGCFLLYNTGPS
IVHSQHGLLTTVGYQLGRKATPYYALEGSVSIAGAAFNWLRDNLGLIQNTAQIESMASTV
DNSLDVYFVPAFNGLYAPYWNQDARGVLCGLSEETTSEHIVRATLEAVCFQVRDILDSMH
KDCKIPLAKLMVDGGMTVNNLFLQLQADLVGIHVLRAKIAETTALGAAMAAYKTVAPQYN
MEGPLSKADDRKAIKSKISSTERNLRYQKWKMAIERSLNWETSTLVQGERESFDGA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggatagctctggaagtgaagcaggagatgccagtatggctggtccatttgttggcgcc
atcgatgagggcaccacatcggctcgtttcatgatatttcgtgcgggtaccgatgacatt
gtctgttatcatcaaatcgaggtgccttcgattttcgtcaaggagggctggtgtgaacag
gatccgtgcgtcattaccaacactgtcaacgattgcatagagggcgcctgccaaaagctg
gtcgcactgggcggcaaaatcgagaatattttggctattgggattaccaatcagcgcgag
tcgaccgtagtctgggatcggcatacgggtaaggcgctggcgaatgcgatcatttggctg
gacaatcgcaccaccagcaccgtcgaggatctgctggagacgataccgaacaatgcgcgc
aacattaactatttgcgaccgctttgcggcctgccactctcgccgtacttctccggcgtc
aagttgcgctggctgcgcgacaatgtggccagcgtgaagaaggcaatggatgccggcgat
gccatgttcggcacaatcgacacctggctgatgtacaatctgacgggtggacccaagggc
ggtgtgcacaagacggatgtgacaaatgcgtcgcgcacaatgctgatgaatattgagaca
ctgcaatgggatcccgcattgctcaagttctttggcctgcccgccagcattctgccagag
atttgctcgagtgccgagcactttggcaccattgcggcgggcacactgcgaggcatcagc
attgcggcggatctgggggatcagcaagctgctctcgtgggtcaacaatgtttggccaag
ggacaggcgaaggctacctatggcactggctgctttctgctctacaatacgggcccatcg
attgtgcactcccagcatggcctgctgacaactgtgggttatcagctgggacgcaaggca
acgccttattatgcacttgaaggtagtgtttccatagccggtgcagcattcaactggcta
cgtgataatctgggcctgatacagaatacggctcagattgagagcatggccagcactgtg
gataattccttggatgtgtactttgtgcccgcatttaatggactgtatgcgccgtactgg
aatcaggatgcacggggtgttctctgcggcctcagcgaggagacgaccagcgagcatatt
gtgcgtgccactttggaggcggtctgcttccaggtgcgcgatatactcgactccatgcac
aaggactgcaaaattccgctggccaaactgatggtcgatggcggcatgactgtgaataat
ctgttcctgcagctgcaggctgatctcgtcggcattcatgtgctgcgcgccaagattgcc
gagacaacagcgctgggtgctgctatggctgcctataagacagtggctccgcagtacaat
atggagggaccgctgtccaaggcggatgaccgcaaagcgatcaagtcaaagatcagctcg
acggagcgcaatttacgctatcagaaatggaaaatggccattgagcgttcccttaactgg
gagacgtccacgctggtccaaggcgaacgtgaatccttcgatggtgcctaa

DBGET integrated database retrieval system