KEGG   Drosophila grimshawi: Dgri_GH15672Help
Entry
Dgri_GH15672      CDS       T01061                                 

Definition
GH15672 gene product from transcript GH15672-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 821 aa AA seqDB search
MEELRKHLSKVSVPCGTAPIYKDECVFSYDNPETPTGLYVCLQTFLGFGEAFVCEYAAKT
GNAVFLHIKRERKLKAGESHHDQTTEAGPERKITRLAIGVDGGYNESDLAKKYEIKDTYS
IVVAPHLDKKLPYPDAELPMRVTQAVEAVLEADSAIAKLEKATLMGTWDGEVRQASKHAE
NLQQLDNGKKIPPAGWQCEKCELTNNLWLNLTDGSIMCGRKFFDGSGGNDHAVEHYRQTG
YPLAVKLGTISADGKSDVFSYPEDDMVLDPHLGKHLKHFGINMAAMQKCEKSMVELELEI
NQRIGEWSALTESESELQPLAGPGLTGMRNLGNSCYINSVMQVLFAIPDFQQRFVGSGAE
HYFKAFPSDPANDFNIQMAKLGNGLQSGKYSSVSENSLDMEHMTGISPVMFKNIVGKNHP
EFSTKQQQDANEFYLHLLSLLDRNSRNQFNPADALKFQLEDRVECMTSHKVNYRLREEYT
FELPIPLEQATNLDEVREYQEREQAARASGQRLLDRDIVRHKVPLQACLERFFGTEIIDQ
FFSTAINAKTTAKKNTLMATMPDFLMIHLGKFTLGDDWVPKKLDVSVDMPDDLDLSVWHA
RGGLQAGEELLPEPTAEPPKFVFDEHVMSELVNMGFPPDACKRACFHTQNSSLEAASNWL
MEHIADPDISDPFEVPANNRIGDGAAAKFVANPESLAMLMSMGFDEMQAVAALKATDGNV
ERATDWIFSHADCIDEVPPVSAPTPASAPTTATATSNYRDGNGKYKLMAFISHMGTSAQV
GHYVCHIRKQGEWVIFNDTKVAKSQNPPKDLGYLYLYMRED
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctacgcaagcatttatcaaaggtgagcgtaccatgtggtacagcgcccatc
tacaaagacgaatgcgtgttctcctacgacaatccggaaaccccaacgggactctacgtc
tgtctgcagacatttctaggctttggcgaggctttcgtctgcgaatatgccgctaaaacg
ggcaatgccgttttcctgcacatcaagcgcgaacgcaaactgaaggcaggcgaatcccat
cacgaccaaacgacggaagccggcccagagcgtaaaattacacgtttggccatcggcgtc
gatggtggctacaatgaatcggatcttgccaaaaagtatgagattaaggatacgtacagc
attgttgtggcaccgcatctggacaagaagctaccctatccggatgcagagctacccatg
cgtgtcacacaggccgtggaggcggtgcttgaggcggactcagccattgccaagctggag
aaggcaacgctaatgggcacctgggatggcgaggtgcgtcaggcgtccaaacatgcggag
aatctgcagcagctggacaacggcaagaaaataccgccagctggctggcaatgcgaaaaa
tgtgagctgaccaacaatctgtggctgaacctcacagatggctccattatgtgtggacgc
aaattcttcgatggcagcggtggcaatgatcatgccgtggagcattatcgccagacgggc
tatccactggcagtcaaactgggcacaattagtgctgatggtaaatcggatgtgttctct
tatcccgaggatgatatggtgctggatccacatttgggcaagcatttaaagcattttggc
atcaatatggcggcgatgcaaaagtgtgagaagtccatggttgagctggagctggaaatt
aatcagcgcattggggagtggtccgctctgacggagagcgagagtgaactgcaaccgttg
gccgggcccgggctgacgggcatgcgcaatctgggcaactcgtgctacatcaacagtgtg
atgcaggtgctctttgccatacccgatttccagcagcgttttgtgggcagtggtgccgag
cattacttcaaggcatttcccagcgaccccgccaacgatttcaacatacaaatggccaag
ttgggcaatggcctgcagtccggtaaatatagcagcgtcagtgagaactcgctggacatg
gagcacatgacgggcatatcaccggtcatgttcaagaatattgtcggaaagaatcatccg
gaatttagcacgaaacagcagcaagatgcgaatgaattctatttgcatttgttgtcgctg
ctcgatcgcaattcacgcaatcaattcaatcccgccgatgcgctcaagtttcagctggag
gatcgtgtcgagtgcatgaccagtcacaaggtgaactacaggctgcgcgaggagtacacc
ttcgagctgcccatacccctcgagcaggccacaaatctggacgaggtgcgtgaatatcag
gagcgggagcaggcagctcgggcgagcggccagcgtctcctggatcgggatattgtgcgg
cataaggtgcccctgcaagcgtgcctcgaacgtttctttggcaccgagatcatcgaccag
ttcttctccacggccatcaatgccaagacgacggccaagaagaacacgctgatggccacc
atgcccgatttcttgatgatccatttgggtaaatttacgctgggcgatgattgggtgccc
aagaaactggacgtttcagtggatatgccagatgatctggatctgagtgtttggcatgct
cgaggtggcctgcaggctggagaggaattgctcccggaaccgactgcagagccgccaaaa
tttgtatttgatgagcatgtgatgtcggagctggtcaacatgggttttccgccggatgcg
tgcaaacgtgcctgtttccacacgcaaaatagcagcttggaggctgcttcgaattggctc
atggagcacattgccgatccggatatctccgatccgttcgaggtgccggcaaacaatcgc
attggcgatggcgccgccgcaaaatttgtggccaatcccgaaagtctggccatgctgatg
agcatgggcttcgatgagatgcaagcggtggccgcactcaaagccaccgatggcaacgtg
gaacgtgccacagattggatcttctcgcatgccgattgcatcgatgaggtgcctccagtt
tcagcgccaactccagcttcagctccaacaactgccacggcgacgagcaattatcgcgat
ggcaatggtaaatataaattgatggcgttcatctcgcatatgggcacctctgcccaggtg
gggcactatgtgtgccacatacgcaaacagggcgaatgggtgatcttcaatgacaccaag
gtggccaagtcacagaatccgcccaaggatctgggctatctgtatttatatatgcgcgaa
gactaa

DBGET integrated database retrieval system