KEGG   Drosophila grimshawi: Dgri_GH15691Help
Entry
Dgri_GH15691      CDS       T01061                                 

Definition
GH15691 gene product from transcript GH15691-RA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dgr  Drosophila grimshawi
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dgri_GH15691
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dgri_GH15691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 559 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDEAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KSRLFENLRMLPHAPGVQITAIPEDAINDESDDDEKVDKDERLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRNYKGQRKRPRLDKEPIITNSSNKTSSEASSDIKDEKEKVEAVDGEEA
TAVATTNNTAGGGGSGSNNNSSSNTGSGSSSNNNNANSSSNNSNNSSGSNKGNNDNDAAS
VATTGGASATKGGAKENNI
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgcatagcaaaaagcgcgtttgctattattacgacagtgatattggcaattat
tattatggccagggacatccgatgaagccgcaccgcatacgcatgacacacaatctgctg
ctcaactacggcctctatcgcaaaatggaaatttaccgcccgcataaggctacagctgat
gagatgactaaattccattcggatgaatatgtgcgctttttgcgctccattcgacccgat
aatatgacggaatataataaacaaatgcagcgatttaatgtcggcgaagattgtcccgtc
ttcgatggactctacgagttctgccagctgtctgcgggtggatctgtggcagctgccgtc
aagctcaacaaacaggcgtcggagatctgcatcaattggggcggtggcttacatcatgcc
aagaaatcggaggcatccggtttctgctatgttaacgatattgttttgggcattttggag
ctgttgaaatatcatcagcgtgtgctctacatcgacatcgatgtgcatcacggcgatggc
gtcgaggaggcattttataccacagatcgcgtgatgactgtcagttttcacaagtacggc
gagtattttccgggcactggcgatttgagggacattggcgctggcaaaggcaaatattat
gctgtcaatattccactcagagatggcatggatgacgaggcatacgagagcatctttgtg
cccatcatctcgaaggtaatggagacctttcagccagctgccgttgtgctgcagtgtggg
gcagattccctcacaggagatcggctcggctgcttcaatctgacggtgaaggggcatggc
aagtgtgtggagttcgtaaagaaatataatctgcccttcctcatggttggtggcggtggc
tacaccattcgcaatgtctctcgctgctggacctatgagacttctgttgcactcgccgtg
gaaatagccaatgagttgccgtacaatgattatttcgaatattttggccccgatttcaag
ctgcacatcagtccaagcaatatgacgaatcagaatacgtctgagtatctggagaagatc
aagagtcgtctctttgagaatctgcgcatgttgccacatgcgccgggcgtacagattacg
gctataccggaggatgccatcaacgatgagtccgacgacgatgagaaggtcgacaaggac
gaacgtctgccgcagagcgacaaggataagcgcattgtgcccgagaacgagtattccgac
tcggaggacgagggcgagggcggcagacgggacaatcggaactacaaaggacagaggaag
cggccacgactcgacaaggagcccatcatcaccaattccagcaacaaaacatcctcggaa
gcctccagcgatatcaaggatgagaaggagaaggtcgaggccgttgatggcgaggaggca
actgcagtagcgacaacaaacaacacagcaggcggcggcggcagcggcagcaacaacaac
agcagcagcaacaccggcagcggcagcagcagcaacaacaacaacgccaatagcagcagc
aacaatagcaacaacagcagcggcagcaacaagggcaacaacgacaacgatgcggcgagt
gtggcaacaacgggtggcgcctccgcgactaaggggggcgccaaggagaacaacatttga

DBGET integrated database retrieval system