KEGG   Drosophila grimshawi: Dgri_GH15752Help
Entry
Dgri_GH15752      CDS       T01061                                 

Definition
GH15752 gene product from transcript GH15752-RA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dgr  Drosophila grimshawi
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dgri_GH15752
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dgri_GH15752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 744 aa AA seqDB search
MSYVLSNDAATASVVACNTNSIAEQPHKDAGMMHSNLLIFIWRRKLSFLLLASGLVLLGL
WTWAILVDTTKTLPTTLTQQQQQSNNLQSSEANYQHVHIIQKLIAQANRVLRAERQKDIV
EHPSPVQRLLGNVRFVRPTQAKKAPLPLADSYLFEQERLKILEQQQRQRNAGMEELNANA
DDDRMLSSAERQTQYEHELQRMGVPVVAGIGPDGPRAPAERLVHLDLKGAPPKLSFLKQM
LPVLRALGATGLLIEYEDMFPYSGVLQSLAAHNAYKEAELKDFLETAWVEYGLSVMPLVQ
TFGHLEYALKLSGFEQLRELAESPQSICPSQPQSMALLEQMLTQVIELHMRPSPANATKA
TPELPIKFTHLHIGCDEVQRMGECSLCRQRMRSELFLTHVISLAHFVRRRWPQLHVVIWD
DQLREMTLSELQNSQIGTYVEPMVWVYASDIYHYIQPQLWDTYAKVFPSAWAASAFKGAF
GESLLVPPLQQHLENNIRWLAVIAKEGGRFAKGFRGLALTGWQRYDHFAVLCELLPVGMP
SLMTSLSTVAKGYFSTNPRDNELLRVLRCVFQPDSRRSGHPWLELHPNAHYSQLFAVCSY
PGHLVFKYALRLYDKLSEVRNYLQQTKEHSAWLSNYNVRHNFSSPLRVLELTARTPQLIE
ELRVMARESQQLLWEVYDEHTVAEFVEQHIYPSISALHQQLVSGQSMLQRRTWPQRPLPL
SPELQQDMGLIPTHDQHHQQQQQH
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgtgctgagcaatgatgctgccacagccagcgttgttgcctgcaacacaaat
agcattgctgaacagccacacaaggatgcaggcatgatgcactcgaatttgctgatattt
atttggcgccgaaaactttcatttctgctgctggcgtctggactggttttactaggtctc
tggacatgggccatacttgtcgatacgaccaaaacactgccaacaacacttacacaacaa
cagcaacagtcgaacaatctacaatcgagtgaggccaattatcagcacgttcacatcatc
cagaaactgattgctcaggcgaatcgtgtcctgcgtgctgaacggcaaaaggatatcgtt
gagcatccatcgccagtgcaacggctattgggcaacgtgcgctttgtgcgtcccacacag
gccaagaaggcaccactgccactagccgatagctaccttttcgaacaggagcgtctcaaa
attctcgagcagcagcagcgtcaacgcaacgccggcatggaggagctgaatgccaatgcc
gatgatgatcgcatgctcagctctgcggagcgtcagacccaatacgagcacgaactgcaa
cgtatgggtgttccagttgttgcgggcattggtcccgatggaccacgtgcgccagccgag
cgactggtgcatctcgatctcaagggtgcgccgccgaagctcagtttcctcaagcaaatg
ctgcccgtgctgcgcgccttgggcgccacaggtctgctcattgagtacgaggacatgttt
ccctacagcggcgtcctccagtcacttgctgctcacaatgcctacaaagaagccgaattg
aaggattttctagagacagcttgggtggaatatggactgagcgtaatgccgctggtgcag
acatttgggcacctggagtacgcactgaaactgtccggctttgagcagttgcgagaactt
gccgaaagtcctcaatcgatatgccccagtcagccgcagagtatggcgctgctggagcag
atgctcacccaggtgattgagctgcacatgcgaccgtcgccggcaaatgcaacgaaggcg
acgccggagctgcccattaagtttacgcacctgcacattggctgtgatgaggtgcagcga
atgggtgaatgctccctgtgccgtcaacggatgcgcagcgaactgtttctcacgcatgtg
attagcttggcgcactttgtgcgtcgccgttggccgcagctgcacgtcgtcatctgggat
gatcagttgcgcgagatgactttgagtgaactgcagaactcacagatcggcacctatgtg
gagcccatggtgtgggtctatgccagcgatatctatcactatatacagccccagctgtgg
gatacctatgcgaaggtctttcccagtgcctgggcggcatccgcatttaagggtgccttt
ggggagagtttgttggtgccgccgctgcaacagcatctcgagaataatatacgctggctg
gctgttattgccaaggaggggggacgctttgccaaaggctttagaggattggcgttgacg
ggttggcagcgttatgatcactttgctgtgctctgtgaactgctgccagtgggcatgccc
agtttgatgacatcgttgtccaccgtcgccaagggttattttagcaccaatccgcgggac
aacgaactgttgcgtgtgctgcgctgtgttttccaaccggatagtcgacgatccggtcat
ccctggttggagctgcatcccaatgcccactatagtcaactgtttgctgtgtgcagctat
ccgggacatctggtgtttaagtatgcgctccgcttgtacgacaaactatccgaggtgcgt
aactatctgcagcagacgaaggagcacagcgcctggctctccaactataatgtgcggcac
aatttcagttcgccactgcgcgtcctggagctgacggcgcgcacgcctcaactgatcgag
gagttgcgcgtgatggcgcgtgaatcacagcaactgctgtgggaggtctacgatgagcat
acggtggcggagtttgtggagcagcatatttatcccagcataagtgcactgcatcagcag
ttggtcagcggtcaatctatgctgcagagacgcacttggccgcaacggccgctgcccctc
tcccccgagctgcagcaggatatgggattgattcctacacacgatcagcaccatcagcag
cagcagcagcactga

DBGET integrated database retrieval system