KEGG   Drosophila grimshawi: Dgri_GH15857Help
Entry
Dgri_GH15857      CDS       T01061                                 

Definition
GH15857 gene product from transcript GH15857-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dgri_GH15857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 429 aa AA seqDB search
MPKSIGNCCLALLFLLVLGTPAISSRVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTEP
IFALVAQALHATNVRVGRLDCTKYPAAAREFKVRGYPTIMFIKGNMEFSYNGDRSKDELV
DYALRMSGPPVQLVTRTESVDMLKGSHTIFFMFVGEQQGVVWDTYYAAAEGYQEHGFFYA
TSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHVAHEMDPNDVNETIFQWVNVERFTLFP
KVTRFNIHQLLKTKKFLVLAVVQEDKLSQIATHELEFRDMVEGVIRKHRPRYHDKFQFGW
IGEPSIAHSIILDQMPTPHLIALNSTTQHHYIPEDDPLQMTPQALHLFLESINNESATVY
GGDSYFVRVNRALFELKRSMREMWRGNPVLMTVIFGLPLGFLSLIMYSIFCGDCLVTEEE
QEEDHEKKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaatcaattgggaattgttgcctggcattgttgtttctgctggtgctgggaaca
ccggcgatatcctcgcgtgtcctggagctcagcgatcgtttcatcgatgtgcgtcacgag
ggccaatggctggtgatgttctatgccccctggtgtggctactgcaagaagacggagcca
atttttgcattggttgcccaagcattgcatgcgacaaatgtgcgagttggccgcttggat
tgcaccaaatatccagcggcagccagagagttcaaggtgcgtggctatcccaccattatg
ttcatcaagggcaacatggagttcagctataatggagatcgcagcaaggatgaactcgtt
gattatgctttgcgcatgtcaggtccgccagttcagttggttacccgcacggagagtgtg
gatatgttgaagggatcccacacgatcttctttatgtttgtgggggagcaacagggcgtt
gtgtgggacacgtattatgccgccgctgagggctatcaggagcatggcttcttctatgcc
accagcgaggatattgctgctcagcatttcgatttcgagaaattgccagcggtgattgtt
tacaaggaggaacagcatcatttctatccacacggacatgttgcccacgaaatggacccc
aatgatgtcaatgagaccatctttcagtgggtgaatgtagagcgttttacactcttcccc
aaggtgacgaggtttaatattcatcagctgctgaagaccaaaaagtttttagtcctggct
gtggtgcaggaggataaactcagtcagatagccacacatgagctggagttccgtgacatg
gttgagggcgtcatacggaaacatcgaccgcgatatcatgacaaattccaatttggatgg
attggcgagccatcgattgcccattccataatcctggatcagatgccaacgccgcatttg
atagcattgaactcgacgacgcagcatcattatatacccgaagatgatccgctgcagatg
acgccgcaggctctccacttattcctggagtccattaacaatgagagcgccactgtctac
ggaggcgattcctattttgtgcgcgtgaatcgcgccctgttcgagctgaagcgatcgatg
cgcgagatgtggcgaggtaatccagtgctgatgactgtgatctttggattaccgttgggt
ttcctctcgctcatcatgtactccatattctgtggcgattgtctggtcaccgaggaggag
caagaggaggatcacgagaagaaggagtaa

DBGET integrated database retrieval system