KEGG   Drosophila grimshawi: Dgri_GH15903Help
Entry
Dgri_GH15903      CDS       T01061                                 

Definition
GH15903 gene product from transcript GH15903-RA
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dgr  Drosophila grimshawi
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dgri_GH15903
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Dgri_GH15903
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Dgri_GH15903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 182 aa AA seqDB search
MVQVWFMDSDESDQRLQHKRQPAEYLDMQALYKRTGVEYFKINADDYVNDKQLIELRSKR
GYSYEDEITCSEQCLPDYLNKLKSFYTEHLHTDEEIRLVLDGSGYFDVRDGEENWLRIEV
IKGDLIIIPAGIYHRFTLDSNNYIKARRYFIGEPVWMPHNRPADKMDCRKAYLQDLAQLS
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggtttggtttatggacagcgatgaaagcgatcagcgtttgcaacacaaacgc
cagccagctgaatatttggatatgcaggcgctctataaaagaaccggcgtggaatacttt
aagatcaatgcggacgactatgtgaacgataagcagctgattgagctgcgcagcaaacgc
ggctacagctacgaggatgagatcacctgttcggagcagtgcctgccggattatctcaac
aagctaaagtcattttatacggaacatttgcatacagatgaggaaattcgactggtgctc
gatggttccggttactttgatgtgcgcgatggcgaggaaaactggttgcgcatcgaggtg
atcaaaggggatttgataataattccggcgggaatctatcatcgtttcactctcgactcc
aataactatataaaagcgcgtcgttattttattggtgaacctgtttggatgccgcacaat
cgcccggctgataaaatggactgtcgcaaggcctacttgcaggatctcgcccaattgagc
aaagcttaa

DBGET integrated database retrieval system