KEGG   Drosophila grimshawi: Dgri_GH15906Help
Entry
Dgri_GH15906      CDS       T01061                                 

Definition
GH15906 gene product from transcript GH15906-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dgr  Drosophila grimshawi
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dgri_GH15906
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dgri_GH15906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 229 aa AA seqDB search
MLSFLFIVNRAFSAGSSIGNGSSSRTIMQATGPRPLVLCGPSGSGKSTLLKRLFAEFPEM
FGFSVSHTTRRPRDGEEHGIHYYFVSRPDMELAIANDEFIETAEFSGNMYGTSKEAVRDI
QSKGRVCILDIEQKGVEQIRRTDLNPILIYNNPPSIEELEQRLRKRGTETEESLRKRLNA
AKMEIDYGLMPGNFHKIVHNEDIDVAYEEFRNFVVDELKKQQALGIYFN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctttctgttcattgtcaatcgtgcattcagcgccggcagcagcatcggcaac
ggcagcagcagcagaacaataatgcaagccactggtccacgaccacttgtgctgtgtggc
ccctcgggctccggcaaaagcacgttgctaaaacgtctatttgctgaatttccggaaatg
tttggattcagcgtctcgcacaccacgcgccgtccgcgtgatggcgaagagcatggcatc
cactattattttgtgagcagaccggacatggagctggccattgccaatgatgagttcatc
gagacggccgagttttcgggcaatatgtacggcaccagcaaggaggcagtgcgcgatatt
cagagcaagggacgtgtctgcattctggacattgagcagaagggcgtcgaacagatacgg
cgaaccgatctcaatcccatattgatatacaacaatccacccagcatcgaggagctcgaa
cagcgtctacgcaagcgaggcaccgaaacggaggaatcgctccgtaagcgtctcaatgct
gccaaaatggaaattgattatggtctgatgccgggcaattttcacaagatcgttcacaat
gaggacatcgatgtggcctacgaggagttccgcaactttgtcgtcgacgagctgaaaaag
cagcaggcactcggcatctattttaattaa

DBGET integrated database retrieval system