KEGG   Drosophila grimshawi: Dgri_GH15953Help
Entry
Dgri_GH15953      CDS       T01061                                 

Definition
GH15953 gene product from transcript GH15953-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dgr  Drosophila grimshawi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dgri_GH15953
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dgri_GH15953
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dgri_GH15953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 245 aa AA seqDB search
MNIRLIQSIGQQAIRCVRLSTLTTRNFGAIAGNQLSQLSPRYCVVLLPFVGVASSVNCSA
AETATKKQQYSTAAALDMSNGDYKNAASIYEFNVKDTHGNDVSLEKYKGQVVLVVNIASK
CGLTKNNYQKLTDLKEKYGERGLTILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVF
AKVDVNGDNAAPIYKYLKAKQTGTLGSGIKWNFTKFLVNKEGIPINRYAPTTDPMDIAKD
IEKLL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaggcttattcaaagcattggtcaacaagcaatcaggtgcgtcaggctctca
acactaacaacgcgtaactttggagcaattgctgggaatcagttgagccagttgagtcct
cgctattgcgttgtgcttttgccatttgtcggcgttgccagcagtgttaattgcagtgca
gcggaaacagcaacgaagaaacaacaatactcaacagcagctgccctcgacatgtctaac
ggggattacaagaacgctgcgtccatttacgagtttaacgtcaaggacactcatggcaac
gatgtctctctggagaagtataagggtcaagtcgtcttggtcgtgaacatcgcctccaag
tgtggcttaaccaagaataactatcagaaattgaccgatctgaaggagaagtatggtgaa
cgtggattaactattttaaatttcccatgcaatcaatttggctctcaaatgccagaggct
gatggtgaggcaatggtttgccatctgcgcgactctaaggcggacattggtgaggtcttt
gctaaggttgatgtgaatggcgataatgctgctcctatctacaaatacctgaaggccaaa
cagaccggcacattgggcagcggcatcaagtggaatttcaccaagtttctggtgaacaag
gagggcatcccaatcaatcgttatgcacccaccaccgatcccatggacattgccaaagat
attgaaaaattattgtag

DBGET integrated database retrieval system