KEGG   Drosophila grimshawi: Dgri_GH15987Help
Entry
Dgri_GH15987      CDS       T01061                                 

Definition
GH15987 gene product from transcript GH15987-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dgri_GH15987
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH15987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 140 aa AA seqDB search
MKFFIVLLALAFAAPALGRTMDRCSLAREMSNLGVPRDQLNKWTCIAEHESSYRTGVVGP
ENSNGSNDYGIFQINNYYWCQPANGRFSYNECSLSCNALLTDDITNSVRCAQKIQGQQGW
TAWSTWKYCNGALPSINDCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcttcatcgttctgcttgctctggctttcgccgcccccgctctgggtcgcacc
atggatcgttgctccttggcccgcgagatgtccaacttgggcgttccccgtgaccagctg
aacaagtggacttgcattgccgagcacgagagctcctaccgcaccggagtggttggtccc
gaaaactccaatggctccaacgactacggcatcttccagatcaacaactactactggtgc
cagcctgccaacggtcgcttctcctacaacgagtgctccttgagctgcaacgctctgttg
actgacgacatcaccaactccgtccgttgcgcccagaagatccagggccagcagggatgg
accgcatggtccacctggaagtactgcaacggtgctctgccctccatcaacgactgcttc
taa

DBGET integrated database retrieval system