KEGG   Drosophila grimshawi: Dgri_GH16077Help
Entry
Dgri_GH16077      CDS       T01061                                 

Definition
GH16077 gene product from transcript GH16077-RA
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dgr  Drosophila grimshawi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dgri_GH16077
Enzymes [BR:dgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dgri_GH16077
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH16077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 327 aa AA seqDB search
MDRKLHSGIHHPTLRLLQESGCEILPHNLMYPVFIISNDDDEQPIASMPGISRYGVNRLR
EHLEPLVAKGLASVLLFGVVDCGLKDEFATHADSKQNPVVLALPKLREWFPTLLIACDVC
ICPYASHGHCGLLGDAGLENAASIERIAGIAVAYGRAGAHVVAPSDMMDNRVRAIKQALI
DAKLNNVSLLAYSAKFASNFYGPFRDAAQSAPAFGDRRCYQLPSGSRNLAMRAVQRDVSE
GADMLMVKPGMPYLDILRQTKDTYPYHTLYVYQVSGEYAMLYHAAKAGAFPLREAVLESM
KGFKRAGADCIITYFTPYLLDIIHKSA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatcgaaaattgcacagtggcatacatcacccaacgctgcgtctgctgcaggaatca
ggctgtgaaatactgccccacaatctgatgtacccggtgttcatcatcagcaacgacgac
gatgagcagccaattgcgagcatgccgggaatctcacgttacggcgtgaatcgattacgc
gagcacttagagccactggtggcgaagggactggcatctgtgctgctcttcggtgtcgtg
gactgtggattgaaggatgagtttgccactcatgcggactccaaacagaatcctgtcgtc
ctggcgttgcccaagctgcgcgaatggtttccgaccctgctcatcgcatgcgatgtgtgc
atctgtccctatgcctctcacgggcattgcggcctgcttggtgatgcgggtctggagaat
gcagcgagcatcgagcgcattgcgggcatagcagtggcatatggcagagctggtgcccac
gtggtcgccccctcggacatgatggacaaccgggtgcgggcgatcaaacaggcgctgatc
gatgccaagctgaacaatgtttcgctcctggcctactcagcaaagtttgcctcaaatttc
tatggtcccttccgggatgcagctcaatcggcgcctgccttcggcgatcgtcggtgctat
cagctgcccagcggttcccggaatctggccatgcgtgcggtgcagcgggatgtgagcgag
ggagccgacatgctgatggtgaagcccggcatgccgtatctggacatattgcgtcagacc
aaggacacctatccgtatcacacgctgtacgtttatcaggtgtccggggaatacgccatg
ttgtatcacgccgccaaggcgggcgcctttccactccgcgaggcagtcctcgaatcgatg
aagggcttcaaacgcgccggtgccgattgcattatcacctattttactccctatctactg
gacataatccacaaatcggcgtaa

DBGET integrated database retrieval system