KEGG   Drosophila grimshawi: Dgri_GH16124Help
Entry
Dgri_GH16124      CDS       T01061                                 

Definition
GH16124 gene product from transcript GH16124-RA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dgr  Drosophila grimshawi
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dgri_GH16124
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Dgri_GH16124
   04068 FoxO signaling pathway
    Dgri_GH16124
   04070 Phosphatidylinositol signaling system
    Dgri_GH16124
   04150 mTOR signaling pathway
    Dgri_GH16124
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dgri_GH16124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1084 aa AA seqDB search
MCEIQYASCQPPHVTAAMCFSIYLWKYDPPDIVDLTCLMPNGVVLQLRVKSTATIREVKA
EMVALGKVQPLGYLIKDACDYQVNGISHYTIEAYTDETKRLIEVQPYFGLLNLGERTDTT
TFSSDYELTKMISDIIGKSFDHQNSHGTPEVEYFRSKVNVICDGIKVERTKYSWQQRLLY
EHPLRLGNSTLMPELIRQRHPTSAFLITVKNENDLSAFTLSVLEHDTPLSLIESTLQKMY
RSQIKINDRANDYILKVSGRDEYLFGDHPLIQFLYIQEMLSDAAVPNVVLQPVMRLDAYI
NHYNEQQNLSLKRPPKPERQIVMEKSIAMLWDLQPKNFTLTLHGVTNVNFDPARAFKVGV
HVGLYHGDRKLCAQRSLDASSSGNSLDFTFEDNDLAFDIQMHNLPRMTRLCIVVFEVTKM
SRSKKSSNSNSSTFKDVYYNNNPLAWVNTTLFDYKNQLRNGRQTLYTWTYADDIQSDDVF
YPLGTVESNPRKDECAVVHLQFHQGSSDIEHTQVCYPSEDDVLQYAADRARANRDKQQQM
VDPEKQLRDLSILLANYSGKDKIYEMVDQDRNIIWERKNEILREFPEELSVLLHCVYWNE
RDDVADIWYLLKQWPLIAIERSLELLDYAYPDPAVRRFAIKCLHYLKDEDLLLYLLQLMQ
AIKHESYLENDLVIFLLERSLRNQRIGHYFFWHLRSEMHTPCMQTRFGLLLEAYLKGCKQ
HVKPLRKQLEVLEKLKQGSVIAKKGSKEKVRNELQKFLHNEHNNGAFQNIQNPLNPSFRC
SRVTPDKCKVMDSKMRPLWVVFENIDQTASDVYIIFKNGDDLRQDMLTLQMLRVMDQLWK
REGMDLRMNIYNCISMEQRLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLYSWLKEH
NKAPEKLNKAIKEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHFKE
KFGVRRERVPFVLTHDFVYVINKGCIDREAKEFCYFQLLCERAFLILRKHGCLILSLFSM
MISTGLPELSSEKDLNYLRETLVLDYTEENARKHFQAKFSEALANSWKTSLNWASHNFSK
NNKQ
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgaaatacaatacgcatcctgccagccgccgcatgtgaccgccgccatgtgcttc
tcgatatatctctggaaatatgatccacccgatattgtggatctcacctgcctgatgccc
aacggggttgtgctccagctgcgcgttaagtcgacggcaaccatacgggaagtgaaggct
gaaatggtggctctgggcaaagtgcaacctttgggctatctgatcaaggatgcgtgtgat
tatcaggtgaacggcatctcgcactacaccatcgaagcgtatacggatgaaacgaagcga
ctgattgaggtccagccgtattttggtctactcaatttgggtgaacgcaccgataccacc
acattttccagcgattatgaattaacgaaaatgatcagcgacatcattggcaaatccttc
gatcatcagaatagccacggtacaccggaggtggaatattttcgcagcaaggtcaacgtt
atatgcgatggcatcaaggtggaacgcacgaaatactcctggcaacagcgattactttac
gagcatccgctgcgattgggtaattcgacactaatgccagagttgatacggcaacgacat
ccaacatcggcattcctcatcaccgtaaagaacgaaaacgatctgagcgcatttacgctc
tccgtcttggagcatgatactccactgagtttgattgagagcacgctacagaagatgtat
cgttcacagatcaagatcaatgatcgcgccaatgactatatactcaaggtgagcggacgg
gatgagtatctgtttggggatcatccgctgatacagtttctttacatccaagagatgctc
tccgatgcggcggtgcccaatgttgtcctccagcccgtcatgcgtctcgatgcgtacatc
aatcattacaacgagcagcagaatctaagtctgaaacgtcccccaaagccggaacgtcaa
attgtgatggagaaatcgattgcaatgctttgggatttgcaaccgaaaaattttacgctc
accttgcacggcgtgacaaatgtgaactttgatccggcgcgtgcttttaaggtgggcgtc
catgtgggactctatcatggcgatcgcaagttgtgcgcccagcgcagtttggatgcttcg
agctcgggcaactcattggattttacatttgaagacaatgatttggcattcgatatacaa
atgcacaatttgccacgcatgacacgactctgcattgtggtctttgaggtgacgaaaatg
tcgcgctcgaagaagtcttcgaacagcaacagcagcacctttaaggatgtctactacaac
aataatcccttggcatgggttaatacaacgctcttcgactataagaatcagttgaggaat
ggtcgccagactctgtacacctggacctatgcagatgatatacaatcagatgatgttttc
tatccgctgggcaccgttgagtcgaatccgcgcaaagacgagtgcgccgtagtccatctg
caattccatcagggaagcagcgacattgagcacacgcaagtctgctatcccagcgaggat
gatgtgctgcaatatgccgcggatcgggcgcgagcgaatcgcgataaacaacagcaaatg
gtagatcctgagaaacagttgcgagacctgagcattctgctggccaactattcgggcaaa
gataaaatctacgagatggtcgatcaggatcgcaacatcatctgggaacgcaaaaacgaa
atattacgcgaatttccggaggagctgtccgtgctgctgcactgcgtctattggaatgag
cgcgatgatgttgccgacatttggtatctcctcaagcagtggccactcatcgccatcgaa
cgctcgttggagttgctggactacgcctatccggatccggctgtgcgtcgatttgccatc
aaatgtctgcactacctaaaggacgaggatctgttgctgtatctgctgcagctgatgcag
gcgatcaagcatgaatcgtatttggagaacgatctggttatatttttgctggagcgctcg
ttgcgcaatcaacgcattggacactatttcttttggcatttgcgctccgaaatgcatacg
ccttgcatgcagacacgattcggattgctgctggaggcttatctcaagggttgcaagcag
catgtgaaaccgttgcggaagcagctcgaagtgctggagaaactgaagcagggttcggtg
atagcgaagaagggcagcaaggagaaggtgcgcaatgagctgcaaaagtttctgcacaac
gagcacaacaacggcgccttccagaacatccaaaatccgttgaatcccagcttcagatgc
agccgcgtcacgcccgacaagtgcaaggtgatggacagcaagatgcgaccgttatgggtt
gttttcgagaacatcgatcagaccgcgagcgatgtgtatatcatattcaaaaatggtgat
gatctgcgccaggatatgctcaccctgcaaatgctgcgcgttatggatcagttgtggaaa
cgcgaaggaatggatttacgcatgaacatctacaattgcatcagcatggagcagagattg
ggcatgatcgaggtggttcgacatgcggagacaattgccaacatacaaaaggagaagggt
atgttttcggcgacttcgccgtttaaaaagggttcgctctacagttggctcaaggagcat
aacaaggcgcccgagaaactcaacaaggccatcaaggagtttacgctcagctgtgccggc
tactgtgttgcaacatatgtcctcggcgttgccgatcgtcattcggacaacataatggtc
aagcgtaatggacagcttttccacatcgattttggccatattctgggccattttaaggag
aagtttggtgtgcggcgtgaacgtgttccttttgtgctaacacacgactttgtctatgtc
atcaacaagggatgcattgatcgcgaggcaaaggaattttgttattttcagctattgtgc
gagcgcgcctttttaattttacgtaaacacggctgccttattttatcgctgttctcaatg
atgatttcaacgggattgccggaactgtcctcagaaaaggatctaaactatttacgtgag
actttggtgctggactacacggaggagaatgcgcgcaaacatttccaggcgaaattcagc
gaagctttggccaattcgtggaagacctcactcaattgggcatcgcacaatttttcgaaa
aacaacaaacaatga

DBGET integrated database retrieval system