KEGG   Drosophila grimshawi: Dgri_GH16207Help
Entry
Dgri_GH16207      CDS       T01061                                 

Definition
GH16207 gene product from transcript GH16207-RA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dgr  Drosophila grimshawi
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dgri_GH16207
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dgri_GH16207
Ubiquitin system [BR:dgr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Dgri_GH16207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 915 aa AA seqDB search
MIQEPVQAAIWHCLNHYDHKDAVFLAERLCSEVESDETIFLLATSYYRSSQLHQAYWLLS
EKSRRSPQCRFLQAKCAYELKKLAEAESALVSNGFADNKHFDEMQREFGELACFAYQLMA
KICVRTERQKLAVSALRRALKLNPFMWHAFADLCLLGQDTDTAAIFQIQNTDVFNTCQGS
SANANSMVLFGGNAANEQQQQQQLENLLLNNLSNNSNFILSTPVEQQQQQQQQQNNNSSI
VTLQNLITPNNNINNNISNNNNNNLNSSITMLRGGVQQQQQQQQQNNANMNSSMMPLEDT
PMGYATQVHDANNGTPFRKQFKYLSTISPLTPSFGIMPLTSPCDGGSAVLQANLSMSAYS
PQMLVEVNQEPKIIGKKLKTHVGGLINRQEKTKPAVFTQTGNITPRTPNNLGVNAPPNPN
AAVRRSSRLFSNSAYSVKENNKSPNITNNNKFVQPRSPPRKTKSSRMTKICLSNELIDEK
THHHLAEKLSEKQSRKEKEKIETITSAATAGNNQSAINNRSTEDAKVLLNNSLNNAQTLA
HQLLTMKKQSADGLMLLLRDLAEGYKLLSTFQCKTAIKLLETTIPKHHLNSSWVQSLIGM
CLYELRDYENAVLIFKRIHETEPSRLDYMEIYSTSLWHLQKEVALSALAQDLIGQDKSNP
VTWCVAGNCFSLHKEHETAIKFFKRAVQVDADFVYSYTLLGHELVLTEEFDKAMDYFRSA
VVRDPRHYNAWFGIGTIYSKQEKYELAELHYVKALKINPQNSVILVHIGAMQFFMQKKDM
ALQTLNTAASLDPKNPLARFHRGSIYFSLGKYQEALRELEELKEIVPKESVVFYLIGKIH
KTLGNMDLALMHFSWATDLDPKGANNQIKDAFDSMAHPSCCPGVDNALDVDFDPTSERSD
DSTQAQQDVSYDSDY
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgatacaagagcccgttcaggccgccatatggcactgcctcaatcactacgatcataaa
gatgctgtttttctggcggaacgcctctgctcagaagtggaaagcgacgagacaatattt
ttgctggccaccagctattatcgttcaagccaattgcatcaggcatattggctactgtcg
gagaagtcacgtcgctcgccccaatgccgcttcttgcaggccaaatgcgcatacgagctc
aagaaattggcggaagcagagagcgcactcgtttcaaatggatttgccgacaataaacac
tttgatgaaatgcagcgagaattcggcgaactcgcctgcttcgcctatcagctgatggcg
aagatctgtgtgcgtactgagcgccagaagctggcggtgagcgcgttgcgtcgcgctctc
aaactgaatccgtttatgtggcatgcgttcgccgatttgtgcctgctgggtcaggatacg
gatacagcggcaatattccaaattcaaaacactgatgtgttcaacacctgccagggcagc
agcgccaatgccaattccatggtgctgttcggcggcaacgcagctaacgagcagcagcag
caacagcagctcgaaaatctgctgctcaacaacttaagcaataactccaattttatatta
agcacgccagtcgaacagcaacaacaacagcagcagcagcaaaacaacaacagcagcatt
gtcacattacagaatttaataacgccaaacaacaacatcaacaataacataagcaacaac
aacaacaacaatctcaacagctccattacgatgctgcgtggcggcgtacaacaacagcag
cagcagcaacagcagaacaacgccaatatgaattcgagcatgatgccgttggaggacaca
ccgatgggttatgcaacgcaggtgcatgatgcaaataatgggacaccgtttcgcaagcaa
tttaaatatttgtcaacaatatcaccattaacgcccagctttggcattatgccgctgact
agtccctgcgatggcggctcagccgtactgcaggccaatttaagcatgtctgcgtattcg
ccccaaatgctcgtcgaggtcaatcaggagccaaagatcattggcaaaaagttgaaaacc
catgttggtggcctgatcaatcgtcaggagaaaacgaaacccgctgtgttcacgcagact
ggcaacataacgcctcgcactcccaacaatttgggtgtgaatgcaccaccaaatcccaat
gctgcagtgcgtcgaagttcccgtttgtttagcaattcggcatactctgtgaaggagaac
aacaaatcgccgaacataacgaataacaataagtttgtccagccgcgttcaccgccacgt
aaaaccaaatcgtctcgcatgaccaaaatctgtttgagcaatgagctaattgatgagaag
acccatcatcatctcgccgagaagctaagtgaaaagcagtcgcgcaaagagaaggagaag
atcgaaacgatcacatctgctgcaacagcgggcaacaatcaatcggcaatcaacaatcgc
agcaccgaggatgccaaagtgctgctcaacaacagcctcaacaatgcccaaacgctggct
catcagctgctcaccatgaagaagcagtcggcggatggtctaatgctgctactacgggat
ctggccgagggctataagctactctcgacgtttcagtgcaagacggccattaagctgttg
gagacgacgataccaaagcatcacttgaactccagttgggtgcaatcgttgattgggatg
tgcctgtacgagctgcgcgactacgagaatgccgttctcattttcaagcggatacacgaa
acggagcccagtcgcttggactacatggagatatattccacgtcgttgtggcacttgcaa
aaggaggtggccctttcggcgctcgcacaggacctcatcgggcaggataaaagtaatccg
gtcacgtggtgtgtggcgggtaattgtttctcgctgcacaaggagcacgagacggccatc
aaattctttaagcgcgccgtccaagtcgatgcggactttgtatatagctatacactgctt
ggtcacgagctggtacttaccgaggagttcgacaaggcgatggactattttcgatcggcg
gtggtgcgggatccgcggcactacaatgcctggtttggcattggcacaatctactccaag
caggagaaatatgaactggccgagctgcactatgtgaaggcgctgaaaatcaatccgcag
aactcggtcattctggtgcacattggggcgatgcagttctttatgcagaagaaggacatg
gctctgcaaacacttaatacggcagcttcgttggatccaaagaatccgttggcgcgcttt
catcgcggctccatatatttctcgctgggcaagtatcaggaggcgttgcgcgaattggaa
gagctcaaggagattgtgccaaaggagtcggttgtgttttatctaattggcaaaatacac
aagacactgggcaatatggatctggccctgatgcatttcagctgggccaccgatctggat
cccaagggcgcaaataatcaaatcaaagatgccttcgattcaatggcgcatcccagctgc
tgtccgggcgttgacaatgcactggatgtggactttgatccaacctcggagcgttccgat
gactcaacgcaggcgcagcaggatgttagctacgacagcgactactaa

DBGET integrated database retrieval system