KEGG   Drosophila grimshawi: Dgri_GH16268Help
Entry
Dgri_GH16268      CDS       T01061                                 

Definition
(RefSeq) GH16268 gene product from transcript GH16268-RA
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00040  Pentose and glucuronate interconversions
dgr00052  Galactose metabolism
dgr00500  Starch and sucrose metabolism
dgr00520  Amino sugar and nucleotide sugar metabolism
dgr01100  Metabolic pathways
Module
dgr_M00361  Nucleotide sugar biosynthesis, eukaryotes
dgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dgri_GH16268
   00052 Galactose metabolism
    Dgri_GH16268
   00500 Starch and sucrose metabolism
    Dgri_GH16268
   00520 Amino sugar and nucleotide sugar metabolism
    Dgri_GH16268
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dgri_GH16268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6556954
NCBI-ProteinID: XP_001984129
FlyBase: FBgn0123739
UniProt: B4IXV6
AA seq 511 aa AA seqDB search
MLDVPQEAKVRGHQRAPSDSKEFHEVTKRDALRLLENEVDRLLQTTESARRPALQAEMGR
FADLFGRFLQEEGPSLDWNKIQKLPENAVMDYTNLKSPKNEQIRLMLDKLVVIKLNGGLG
TSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKY
KGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKF
LCEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPPEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLSAIDRVLRERTLNMEIIVNNKT
LENGLRVIQLETAVGSAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKSGSLVM
SPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVI
IIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtaccacaagaagcaaaggttcgcggccatcagcgcgctccatccgattcc
aaggagttccacgaggtaaccaagcgcgatgcactgcgtctgctggagaacgaagtggat
cgcctgctgcagacaacggagtcggcgcgccgtccagcgctccaagctgaaatgggtcgc
tttgccgatctattcggacgctttctgcaagaggagggaccctcgctggactggaataaa
attcaaaagctgcccgaaaatgcggtgatggactacaccaatctcaaatcgcccaaaaat
gagcagatacgcctgatgctggacaaactggtggtcattaagctgaatggtggtttgggc
acctcaatgggctgccatggacccaagagtgtcattcccgtgcgttccgatttgacgttc
ctggatctgacggtgcagcagatcgagcatctgaataagacatatgatgccaatgtgccg
ctggtgctgatgaactcattcaacacggacgaagatacggagaagattgtgcgcaagtac
aagggattccgtgtgcagatacacaccttcaatcagagctgctttccacgcattagtcgc
gagcatttcctgcctgtcgccaaagactttgatgtggaaaaggatatggaggcctggtat
ccacctggtcacggtgatttctacgatacgttccgtaactcgggcctgctgaagaagttc
ctttgcgagggtcgagaatactgtttcctctccaacattgataatctgggcgccaccgtc
gatctgaacatcctcaataagctggtgggcgaggagcgtgccaccactcccccagaattc
gttatggaggtcaccgacaagacccgtgctgatgttaagggtggtactcttattcaaatg
gagaacaagctgcgcttgctggaaatcgctcaagtgcccccggagcatgtggatgacttc
aagtccgtgaagaccttcaagtttttcaatacaaacaacatttgggccaacctctcagct
attgatcgtgttctgcgcgaacgcacgctcaacatggagattattgttaacaataagaca
ctggagaatggactgcgtgtcattcagttggagacagctgtgggttcggcgatgaagtgt
ttcgatggcgccattggcatcaatgtgccccgttcccgtttcttgcccgtgaagaaatcg
tctgatctgcttctggtcatgtcgaatttgtatacgcttaagagtggcagcctggtgatg
tcgccacaacgcatgttccccaccacacccctggttaagctgggcgagaatcatttctcc
aaggtgaaagagttcttgggccgctttgccaacatacccgacatcattgagctggaccat
ttgacggtcagcggtgatgttaccttcggacgtggcgtctccttgcgcggcactgtaatt
attattgccaatcatggtgatcgtattgatatacccgccggcgccatactggagaataaa
attgtgtctggcaacatgcgcatcttggatcattaa

DBGET integrated database retrieval system