KEGG   Drosophila grimshawi: Dgri_GH16268Help
Entry
Dgri_GH16268      CDS       T01061                                 

Definition
GH16268 gene product from transcript GH16268-RA
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dgr  Drosophila grimshawi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dgri_GH16268
   00052 Galactose metabolism
    Dgri_GH16268
   00500 Starch and sucrose metabolism
    Dgri_GH16268
   00520 Amino sugar and nucleotide sugar metabolism
    Dgri_GH16268
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dgri_GH16268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 511 aa AA seqDB search
MLDVPQEAKVRGHQRAPSDSKEFHEVTKRDALRLLENEVDRLLQTTESARRPALQAEMGR
FADLFGRFLQEEGPSLDWNKIQKLPENAVMDYTNLKSPKNEQIRLMLDKLVVIKLNGGLG
TSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKY
KGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKF
LCEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPPEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLSAIDRVLRERTLNMEIIVNNKT
LENGLRVIQLETAVGSAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKSGSLVM
SPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVI
IIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtaccacaagaagcaaaggttcgcggccatcagcgcgctccatccgattcc
aaggagttccacgaggtaaccaagcgcgatgcactgcgtctgctggagaacgaagtggat
cgcctgctgcagacaacggagtcggcgcgccgtccagcgctccaagctgaaatgggtcgc
tttgccgatctattcggacgctttctgcaagaggagggaccctcgctggactggaataaa
attcaaaagctgcccgaaaatgcggtgatggactacaccaatctcaaatcgcccaaaaat
gagcagatacgcctgatgctggacaaactggtggtcattaagctgaatggtggtttgggc
acctcaatgggctgccatggacccaagagtgtcattcccgtgcgttccgatttgacgttc
ctggatctgacggtgcagcagatcgagcatctgaataagacatatgatgccaatgtgccg
ctggtgctgatgaactcattcaacacggacgaagatacggagaagattgtgcgcaagtac
aagggattccgtgtgcagatacacaccttcaatcagagctgctttccacgcattagtcgc
gagcatttcctgcctgtcgccaaagactttgatgtggaaaaggatatggaggcctggtat
ccacctggtcacggtgatttctacgatacgttccgtaactcgggcctgctgaagaagttc
ctttgcgagggtcgagaatactgtttcctctccaacattgataatctgggcgccaccgtc
gatctgaacatcctcaataagctggtgggcgaggagcgtgccaccactcccccagaattc
gttatggaggtcaccgacaagacccgtgctgatgttaagggtggtactcttattcaaatg
gagaacaagctgcgcttgctggaaatcgctcaagtgcccccggagcatgtggatgacttc
aagtccgtgaagaccttcaagtttttcaatacaaacaacatttgggccaacctctcagct
attgatcgtgttctgcgcgaacgcacgctcaacatggagattattgttaacaataagaca
ctggagaatggactgcgtgtcattcagttggagacagctgtgggttcggcgatgaagtgt
ttcgatggcgccattggcatcaatgtgccccgttcccgtttcttgcccgtgaagaaatcg
tctgatctgcttctggtcatgtcgaatttgtatacgcttaagagtggcagcctggtgatg
tcgccacaacgcatgttccccaccacacccctggttaagctgggcgagaatcatttctcc
aaggtgaaagagttcttgggccgctttgccaacatacccgacatcattgagctggaccat
ttgacggtcagcggtgatgttaccttcggacgtggcgtctccttgcgcggcactgtaatt
attattgccaatcatggtgatcgtattgatatacccgccggcgccatactggagaataaa
attgtgtctggcaacatgcgcatcttggatcattaa

DBGET integrated database retrieval system