KEGG   Drosophila grimshawi: Dgri_GH16308Help
Entry
Dgri_GH16308      CDS       T01061                                 

Definition
GH16308 gene product from transcript GH16308-RA
Orthology
K05635  
laminin, gamma 1
Organism
dgr  Drosophila grimshawi
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dgr04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1643 aa AA seqDB search
MKRNRWSLIESSSAARLFLAGALLCSCATAALGAQRQPFNAAGGHEMRRTTFLPALECYD
PYGRPQKCTPEFINAAYQLQIKSTNTCGEHMENQFCMQTMNTLNFLKDCAFCRFEDHNPS
FLTDLHDPQSPTWWQSETMNEGIQHPNHVNLTLHLRKSYDITYVRILFRSPRPESFTIYK
RTTENGPWIPYQFYSATCRDTYSLPDSRAIGKGEGEALALCTSEYSDISPLRDGEIAFST
LEGRPGGINFENSLELQDWVTATDIRITLDRLNTFGDELFGDPRVLKSYFYAISDIAVGA
RCKCNGHASKCVASTGMHGERTLVCECRHNTDGPDCDRCLPLYNDVKWKRATSMDVNECK
ACNCNGFADKCFFDANLFNQTGHGGHCLDCRDNRDGANCERCKENFYMRESAHCENCNCD
AVGSRSLQCNSQGKCQCKPGVTGDKCDRCANNYFQFGAHGCQPCGCDARGSDDNTPACDA
ESGICYCKENVEGRRCNECKPGFFNLDKSNRFGCTPCFCYGHTSECHSAPGYSVVSVTSS
FNKHKERWTAIDLNRRDVDIKYNQYSRSIGTTAQGNEYVYFKAPDRFLGDQRASYNRDLK
FKLQLVGQVGPSSSASDVILEGAGSKISLPIFAQSNGIPDQGVREYTFRLHEHHDYQWQP
SQSARGFLSILSNLTAIKIRATYSVQGEANLDDVELQSAHRGAAGQPATWIEQCTCPEGY
LGQFCESCAPRYRHSPARGGPFMPCIPCDCHGHADICDSETGSCICQHNTYGDNCDQCAR
GYYGNALGGTPYDCTRCPCPNDGACMQINSDTVICTECPVGYFGSRCEQCSDGFYGDPTG
LLGPVATCKSCDCNGNVDTNAVGNCNRTTGECLKCIHNTAGGHCDQCLPGHFGDPLALPH
GKCDRCSCYAAGTEQDEQSILRCDQVTGQCHCKPNVIGRDCGECQPGYFNIRSGNGCENC
LCDPVGSYNSTCDKYTGQCHCKPGVVGVRCDQCADYFFGFSSDGCKPCECDESGSKGFQC
DQSGQCPCNDNVEGNRCDRCKENKYDRHRGCVDCPDCYNLVQDAADLHRAKLANLSATLD
EIARTPVTNDEEFEGKLKAVQEKVAMLAQEARSGSGESGQTYVEVINDLHKRLNSMRGHL
TSADALQQDANTEIAKARSNYTQLHNIIDDAKKELQQALELLNDEGAQALAKAKSKSVEF
GEQSDQISDISREARALADRLESEAQFDLKNAKDAMDAVEKAHLLAKNAIDLQQKVGVEL
RTEVRLELDHVKNSLITVAQTSKEALRKANEVYDAALTLLNQVKSQTQPDIDINKLKKEA
VAANERADELLQQIDRLGTGNGEIFADFEKEHDLAQVLLERADAQKKDDIELLERAKAAL
DKATKAVKQGDNTLTEASNTYQTLAGFQSEVQRSSENSDLALQTVPDIQLEIENAGNLIE
KARYALEGANKNANEAKNNAQEAQVKYAEQASKDAELIRRKANETKVAARKLHDEADQLN
HRVTLTEMNIANLEDNSTKDDNLVDDAKRKVGQAKANTQEAQKQIEKASSELSAIKDELE
NLKDINTADLDKLENRLSVVETDISRVNLTERIEKYREQRNIQKKLIDKYDLELSEISKE
VQNIRLISEALPAGCFRRNRLEP
NT seq 4932 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaacaggtggagtctcattgagagctcctccgcggcgcgtctcttccttgcg
ggagctctgctctgcagctgcgcgacggcagcgcttggtgcccaacgtcagcccttcaac
gccgccggcggacatgagatgcgacgcacaacgtttctgcctgctctggaatgctatgat
ccctatggccgaccccagaaatgtacgccggagttcatcaatgctgcctaccaattgcaa
atcaagtcaacgaatacctgcggggagcatatggaaaatcaattctgtatgcagaccatg
aataccctaaactttctgaaggactgcgcattctgcagatttgaagatcacaatccatca
tttctaacggatttgcacgatccacaaagcccaacctggtggcaatcggagacaatgaac
gagggcatacaacatccgaatcatgtgaatttaacgctgcacttgcgtaaatcatacgat
attacttatgtgcgtatcctgttccgctcgccgcggcccgagtcatttacgatttacaag
cgcactacggaaaacggtccctggataccctatcagttctacagcgccacctgtcgggat
acctactcactacccgattcacgggcaattggaaagggtgagggcgaggcacttgctctg
tgcactagcgagtacagcgacatctcgccactgcgcgacggtgagatcgccttctccacg
ctggaaggtcgtcccggtggtattaactttgagaacagcctggagctgcaggattgggtg
acagccactgacattcgcatcacactggatcgactgaacaccttcggtgacgagctgttc
ggtgatcctcgcgtcttgaagtcatacttctatgcgatcagtgatattgcagtcggtgcg
cgctgcaagtgcaatgggcatgccagcaagtgtgtggccagcaccgggatgcacggggag
cgtactctggtctgcgagtgtcgccacaatacggatggacccgactgcgatcgctgcttg
ccgctgtacaatgacgtcaagtggaaaagggccacctcaatggatgtgaacgagtgcaaa
gcctgcaattgcaacggctttgcggacaagtgcttcttcgatgcgaatcttttcaatcag
accggccacggcggtcactgtctggactgtcgcgacaatcgcgatggtgccaactgtgag
cgttgcaaggagaacttctatatgcgggaaagcgcacactgcgagaactgcaactgcgac
gccgtcggttcccgttcgttgcagtgcaacagccagggcaagtgccagtgcaaaccgggc
gtaactggcgacaagtgtgatcgatgtgccaacaactacttccagttcggagcgcatggc
tgtcagccctgtggctgcgatgcacgcggctcggatgataatacgccggcctgtgatgcg
gagagcggcatctgctactgcaaggagaatgtcgagggcaggcgctgcaatgaatgcaag
ccgggcttctttaatctggataagagcaatcgttttggctgcacaccctgcttctgttat
gggcacacctccgagtgccattcagcgcctgggtactccgttgtctcggtcacatccagc
tttaacaagcataaggaacgctggacggccattgatttgaatcgtcgcgatgtggacatt
aaatacaatcagtatagtcgcagcattggcaccaccgcccagggcaatgagtatgtttac
ttcaaggcgccggatcgcttcctcggcgatcagcgtgcctcctacaatcgcgatctgaaa
ttcaagctgcagcttgtgggtcaggtgggacccagcagcagtgccagcgatgttatcctc
gagggcgccggcagcaaaatctcgctgcccatctttgcccaaagcaatggcattcccgat
cagggcgtcagggagtatacgttccgactgcatgaacatcacgactatcaatggcagccc
agccagtcggcgcgaggtttcctctctatactctctaatctgacggccattaagattcgg
gctacgtactcagtgcagggtgaggccaatctcgatgatgtggagctccagtcggctcat
cgaggcgctgccggccagccggcaacctggattgagcagtgcacctgccccgagggctat
ctgggtcagttctgcgaatcatgcgcgccacgctatcgccacagtccggcacgcggtgga
ccctttatgccgtgcataccctgcgactgtcatggccatgcggacatctgtgactcggag
acgggcagctgcatctgtcagcacaatacgtatggtgataactgtgaccagtgcgccagg
ggctactatggcaacgcattgggcggcacaccctacgactgtacacgttgtccctgtccc
aacgatggtgcctgcatgcaaatcaatagcgatacggtcatctgtacggaatgccctgtg
ggctactttggctcacgctgcgaacagtgtagcgatggcttctatggtgatcccactgga
ctgctgggtcctgtggcgacctgcaagagctgcgactgcaatggcaatgtcgataccaat
gcggtcggtaactgcaatcgcaccacgggcgagtgcttgaagtgcatacacaacacagct
ggcgggcactgcgatcagtgcctgcccggacactttggagatccgttggcgctgccgcat
ggcaagtgcgatcggtgtagttgctatgccgccggcaccgagcaggatgaacagagcatt
ttgcgctgcgatcaggtgacaggacagtgccactgcaagccgaatgtaattggtcgcgat
tgtggtgaatgccagcccggatactttaatatacgatccggcaatggatgtgagaattgt
ctgtgcgatcccgtcggcagctacaactccacttgcgacaagtatacgggtcagtgtcac
tgcaagcccggagttgttggcgtgcgctgtgatcagtgcgcagactacttctttggtttc
tcatcggatggatgcaagccgtgcgagtgcgatgagagcggctccaagggcttccagtgt
gaccagagtggtcagtgtccgtgcaatgacaatgtggagggaaatcgctgcgatcgctgc
aaggagaacaaatacgatcgtcatcggggttgcgtggactgtccggattgctataatctg
gtgcaggacgcagccgatctgcatcgcgccaagttggcgaatttgagcgctacactggac
gagatcgcacgcacaccggtgaccaacgatgaggaattcgaaggaaagttgaaagcggtg
caggagaaggtggccatgttggcgcaggaggcacgctccggttctggtgagagcggtcag
acctatgtggaggtcatcaatgatctgcacaagcgactaaacagtatgcgtggccatctg
acaagtgccgatgcactgcagcaagatgccaacactgaaatagccaaggcacgcagcaat
tacacacaactgcacaatatcatcgacgacgccaagaaggagctgcaacaggcattggaa
ttgctcaacgacgaaggtgcccaagccttagccaaggcgaagagcaaatccgttgagttt
ggcgagcaatccgatcagatatcagacatttcgagagaggcacgcgctcttgccgatcgc
cttgagtccgaggcgcaattcgatctaaagaatgccaaagatgcaatggatgcggttgag
aaggcccatctgctggccaagaatgccatcgatttgcagcaaaaggtgggcgtcgagctg
cgcaccgaagtccgcctcgagctggaccacgtgaagaactcactcatcaccgtcgcccaa
acctccaaggaggcgctgcgtaaggccaacgaggtctacgatgcagcactcacactgctc
aaccaagtgaagagtcagacccagccggacattgatatcaacaagctgaagaaggaggcc
gtcgctgccaatgagcgcgccgatgagctactccaacagatcgataggttgggtactggt
aatggcgagatctttgccgacttcgaaaaggaacatgatcttgcccaggtgctgctagaa
cgcgccgatgcacaaaagaaggatgacattgaattgttggaacgcgccaaggctgccctt
gataaggctaccaaggcggtgaagcagggcgacaatacactaacggaggccagcaatacc
taccaaaccttagccggattccagtctgaagtgcaaagatcctcggagaattcagacttg
gctttgcaaacggtgcccgacattcagttggagattgagaatgcaggtaatctaatagag
aaggctcgttatgcattggagggtgccaataagaatgcgaatgaagccaagaataatgca
caggaagcccaggtcaagtatgcagaacaggcctcaaaggatgccgagcttatacgccgc
aaggcaaatgagacgaaggtcgctgcccgcaagctgcatgatgaggctgatcagctgaat
catcgcgtcacgctgactgaaatgaacattgcaaatttggaggacaattcaaccaaagat
gataatcttgtggatgatgctaagcgcaaggttggtcaggccaaggccaatacgcaggag
gcacagaagcaaattgaaaaggccagtagcgaactgtctgcgattaaggacgagctagag
aacctgaaggatatcaacacagctgatttggataaattagaaaatcgcctcagtgtcgtc
gagactgatatcagccgtgtaaatcttaccgaacgaattgagaagtaccgagaacagcga
aacattcaaaagaaattaatcgacaaatacgatttagagttgagtgaaatatccaaggag
gtgcagaatatacgtttgatatctgaagcactaccagcgggttgctttaggcgcaatcgc
ttagagccttag

DBGET integrated database retrieval system