KEGG   Drosophila grimshawi: Dgri_GH16308Help
Entry
Dgri_GH16308      CDS       T01061                                 

Definition
GH16308 gene product from transcript GH16308-RA
Orthology
K05635  
laminin, gamma 1
Organism
dgr  Drosophila grimshawi
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dgri_GH16308
Cell adhesion molecules and their ligands [BR:dgr04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      Dgri_GH16308
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      Dgri_GH16308
     Laminin-2 Extracellular matrix (ECM) components
      Dgri_GH16308
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      Dgri_GH16308
   VLA-3
      Dgri_GH16308
     Laminin-10 Extracellular matrix (ECM) components
      Dgri_GH16308
     Laminin-11 Extracellular matrix (ECM) components
      Dgri_GH16308
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      Dgri_GH16308
     Laminin-8 Extracellular matrix (ECM) components
      Dgri_GH16308
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      Dgri_GH16308
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      Dgri_GH16308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1643 aa AA seqDB search
MKRNRWSLIESSSAARLFLAGALLCSCATAALGAQRQPFNAAGGHEMRRTTFLPALECYD
PYGRPQKCTPEFINAAYQLQIKSTNTCGEHMENQFCMQTMNTLNFLKDCAFCRFEDHNPS
FLTDLHDPQSPTWWQSETMNEGIQHPNHVNLTLHLRKSYDITYVRILFRSPRPESFTIYK
RTTENGPWIPYQFYSATCRDTYSLPDSRAIGKGEGEALALCTSEYSDISPLRDGEIAFST
LEGRPGGINFENSLELQDWVTATDIRITLDRLNTFGDELFGDPRVLKSYFYAISDIAVGA
RCKCNGHASKCVASTGMHGERTLVCECRHNTDGPDCDRCLPLYNDVKWKRATSMDVNECK
ACNCNGFADKCFFDANLFNQTGHGGHCLDCRDNRDGANCERCKENFYMRESAHCENCNCD
AVGSRSLQCNSQGKCQCKPGVTGDKCDRCANNYFQFGAHGCQPCGCDARGSDDNTPACDA
ESGICYCKENVEGRRCNECKPGFFNLDKSNRFGCTPCFCYGHTSECHSAPGYSVVSVTSS
FNKHKERWTAIDLNRRDVDIKYNQYSRSIGTTAQGNEYVYFKAPDRFLGDQRASYNRDLK
FKLQLVGQVGPSSSASDVILEGAGSKISLPIFAQSNGIPDQGVREYTFRLHEHHDYQWQP
SQSARGFLSILSNLTAIKIRATYSVQGEANLDDVELQSAHRGAAGQPATWIEQCTCPEGY
LGQFCESCAPRYRHSPARGGPFMPCIPCDCHGHADICDSETGSCICQHNTYGDNCDQCAR
GYYGNALGGTPYDCTRCPCPNDGACMQINSDTVICTECPVGYFGSRCEQCSDGFYGDPTG
LLGPVATCKSCDCNGNVDTNAVGNCNRTTGECLKCIHNTAGGHCDQCLPGHFGDPLALPH
GKCDRCSCYAAGTEQDEQSILRCDQVTGQCHCKPNVIGRDCGECQPGYFNIRSGNGCENC
LCDPVGSYNSTCDKYTGQCHCKPGVVGVRCDQCADYFFGFSSDGCKPCECDESGSKGFQC
DQSGQCPCNDNVEGNRCDRCKENKYDRHRGCVDCPDCYNLVQDAADLHRAKLANLSATLD
EIARTPVTNDEEFEGKLKAVQEKVAMLAQEARSGSGESGQTYVEVINDLHKRLNSMRGHL
TSADALQQDANTEIAKARSNYTQLHNIIDDAKKELQQALELLNDEGAQALAKAKSKSVEF
GEQSDQISDISREARALADRLESEAQFDLKNAKDAMDAVEKAHLLAKNAIDLQQKVGVEL
RTEVRLELDHVKNSLITVAQTSKEALRKANEVYDAALTLLNQVKSQTQPDIDINKLKKEA
VAANERADELLQQIDRLGTGNGEIFADFEKEHDLAQVLLERADAQKKDDIELLERAKAAL
DKATKAVKQGDNTLTEASNTYQTLAGFQSEVQRSSENSDLALQTVPDIQLEIENAGNLIE
KARYALEGANKNANEAKNNAQEAQVKYAEQASKDAELIRRKANETKVAARKLHDEADQLN
HRVTLTEMNIANLEDNSTKDDNLVDDAKRKVGQAKANTQEAQKQIEKASSELSAIKDELE
NLKDINTADLDKLENRLSVVETDISRVNLTERIEKYREQRNIQKKLIDKYDLELSEISKE
VQNIRLISEALPAGCFRRNRLEP
NT seq 4932 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaacaggtggagtctcattgagagctcctccgcggcgcgtctcttccttgcg
ggagctctgctctgcagctgcgcgacggcagcgcttggtgcccaacgtcagcccttcaac
gccgccggcggacatgagatgcgacgcacaacgtttctgcctgctctggaatgctatgat
ccctatggccgaccccagaaatgtacgccggagttcatcaatgctgcctaccaattgcaa
atcaagtcaacgaatacctgcggggagcatatggaaaatcaattctgtatgcagaccatg
aataccctaaactttctgaaggactgcgcattctgcagatttgaagatcacaatccatca
tttctaacggatttgcacgatccacaaagcccaacctggtggcaatcggagacaatgaac
gagggcatacaacatccgaatcatgtgaatttaacgctgcacttgcgtaaatcatacgat
attacttatgtgcgtatcctgttccgctcgccgcggcccgagtcatttacgatttacaag
cgcactacggaaaacggtccctggataccctatcagttctacagcgccacctgtcgggat
acctactcactacccgattcacgggcaattggaaagggtgagggcgaggcacttgctctg
tgcactagcgagtacagcgacatctcgccactgcgcgacggtgagatcgccttctccacg
ctggaaggtcgtcccggtggtattaactttgagaacagcctggagctgcaggattgggtg
acagccactgacattcgcatcacactggatcgactgaacaccttcggtgacgagctgttc
ggtgatcctcgcgtcttgaagtcatacttctatgcgatcagtgatattgcagtcggtgcg
cgctgcaagtgcaatgggcatgccagcaagtgtgtggccagcaccgggatgcacggggag
cgtactctggtctgcgagtgtcgccacaatacggatggacccgactgcgatcgctgcttg
ccgctgtacaatgacgtcaagtggaaaagggccacctcaatggatgtgaacgagtgcaaa
gcctgcaattgcaacggctttgcggacaagtgcttcttcgatgcgaatcttttcaatcag
accggccacggcggtcactgtctggactgtcgcgacaatcgcgatggtgccaactgtgag
cgttgcaaggagaacttctatatgcgggaaagcgcacactgcgagaactgcaactgcgac
gccgtcggttcccgttcgttgcagtgcaacagccagggcaagtgccagtgcaaaccgggc
gtaactggcgacaagtgtgatcgatgtgccaacaactacttccagttcggagcgcatggc
tgtcagccctgtggctgcgatgcacgcggctcggatgataatacgccggcctgtgatgcg
gagagcggcatctgctactgcaaggagaatgtcgagggcaggcgctgcaatgaatgcaag
ccgggcttctttaatctggataagagcaatcgttttggctgcacaccctgcttctgttat
gggcacacctccgagtgccattcagcgcctgggtactccgttgtctcggtcacatccagc
tttaacaagcataaggaacgctggacggccattgatttgaatcgtcgcgatgtggacatt
aaatacaatcagtatagtcgcagcattggcaccaccgcccagggcaatgagtatgtttac
ttcaaggcgccggatcgcttcctcggcgatcagcgtgcctcctacaatcgcgatctgaaa
ttcaagctgcagcttgtgggtcaggtgggacccagcagcagtgccagcgatgttatcctc
gagggcgccggcagcaaaatctcgctgcccatctttgcccaaagcaatggcattcccgat
cagggcgtcagggagtatacgttccgactgcatgaacatcacgactatcaatggcagccc
agccagtcggcgcgaggtttcctctctatactctctaatctgacggccattaagattcgg
gctacgtactcagtgcagggtgaggccaatctcgatgatgtggagctccagtcggctcat
cgaggcgctgccggccagccggcaacctggattgagcagtgcacctgccccgagggctat
ctgggtcagttctgcgaatcatgcgcgccacgctatcgccacagtccggcacgcggtgga
ccctttatgccgtgcataccctgcgactgtcatggccatgcggacatctgtgactcggag
acgggcagctgcatctgtcagcacaatacgtatggtgataactgtgaccagtgcgccagg
ggctactatggcaacgcattgggcggcacaccctacgactgtacacgttgtccctgtccc
aacgatggtgcctgcatgcaaatcaatagcgatacggtcatctgtacggaatgccctgtg
ggctactttggctcacgctgcgaacagtgtagcgatggcttctatggtgatcccactgga
ctgctgggtcctgtggcgacctgcaagagctgcgactgcaatggcaatgtcgataccaat
gcggtcggtaactgcaatcgcaccacgggcgagtgcttgaagtgcatacacaacacagct
ggcgggcactgcgatcagtgcctgcccggacactttggagatccgttggcgctgccgcat
ggcaagtgcgatcggtgtagttgctatgccgccggcaccgagcaggatgaacagagcatt
ttgcgctgcgatcaggtgacaggacagtgccactgcaagccgaatgtaattggtcgcgat
tgtggtgaatgccagcccggatactttaatatacgatccggcaatggatgtgagaattgt
ctgtgcgatcccgtcggcagctacaactccacttgcgacaagtatacgggtcagtgtcac
tgcaagcccggagttgttggcgtgcgctgtgatcagtgcgcagactacttctttggtttc
tcatcggatggatgcaagccgtgcgagtgcgatgagagcggctccaagggcttccagtgt
gaccagagtggtcagtgtccgtgcaatgacaatgtggagggaaatcgctgcgatcgctgc
aaggagaacaaatacgatcgtcatcggggttgcgtggactgtccggattgctataatctg
gtgcaggacgcagccgatctgcatcgcgccaagttggcgaatttgagcgctacactggac
gagatcgcacgcacaccggtgaccaacgatgaggaattcgaaggaaagttgaaagcggtg
caggagaaggtggccatgttggcgcaggaggcacgctccggttctggtgagagcggtcag
acctatgtggaggtcatcaatgatctgcacaagcgactaaacagtatgcgtggccatctg
acaagtgccgatgcactgcagcaagatgccaacactgaaatagccaaggcacgcagcaat
tacacacaactgcacaatatcatcgacgacgccaagaaggagctgcaacaggcattggaa
ttgctcaacgacgaaggtgcccaagccttagccaaggcgaagagcaaatccgttgagttt
ggcgagcaatccgatcagatatcagacatttcgagagaggcacgcgctcttgccgatcgc
cttgagtccgaggcgcaattcgatctaaagaatgccaaagatgcaatggatgcggttgag
aaggcccatctgctggccaagaatgccatcgatttgcagcaaaaggtgggcgtcgagctg
cgcaccgaagtccgcctcgagctggaccacgtgaagaactcactcatcaccgtcgcccaa
acctccaaggaggcgctgcgtaaggccaacgaggtctacgatgcagcactcacactgctc
aaccaagtgaagagtcagacccagccggacattgatatcaacaagctgaagaaggaggcc
gtcgctgccaatgagcgcgccgatgagctactccaacagatcgataggttgggtactggt
aatggcgagatctttgccgacttcgaaaaggaacatgatcttgcccaggtgctgctagaa
cgcgccgatgcacaaaagaaggatgacattgaattgttggaacgcgccaaggctgccctt
gataaggctaccaaggcggtgaagcagggcgacaatacactaacggaggccagcaatacc
taccaaaccttagccggattccagtctgaagtgcaaagatcctcggagaattcagacttg
gctttgcaaacggtgcccgacattcagttggagattgagaatgcaggtaatctaatagag
aaggctcgttatgcattggagggtgccaataagaatgcgaatgaagccaagaataatgca
caggaagcccaggtcaagtatgcagaacaggcctcaaaggatgccgagcttatacgccgc
aaggcaaatgagacgaaggtcgctgcccgcaagctgcatgatgaggctgatcagctgaat
catcgcgtcacgctgactgaaatgaacattgcaaatttggaggacaattcaaccaaagat
gataatcttgtggatgatgctaagcgcaaggttggtcaggccaaggccaatacgcaggag
gcacagaagcaaattgaaaaggccagtagcgaactgtctgcgattaaggacgagctagag
aacctgaaggatatcaacacagctgatttggataaattagaaaatcgcctcagtgtcgtc
gagactgatatcagccgtgtaaatcttaccgaacgaattgagaagtaccgagaacagcga
aacattcaaaagaaattaatcgacaaatacgatttagagttgagtgaaatatccaaggag
gtgcagaatatacgtttgatatctgaagcactaccagcgggttgctttaggcgcaatcgc
ttagagccttag

DBGET integrated database retrieval system