KEGG   Drosophila grimshawi: Dgri_GH16374Help
Entry
Dgri_GH16374      CDS       T01061                                 

Definition
GH16374 gene product from transcript GH16374-RA
Orthology
K06634  
cyclin H
Organism
dgr  Drosophila grimshawi
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dgr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dgr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 325 aa AA seqDB search
MYPFSSQKRSWTFANEAQLQAFRVEQNTKYINEHESEAASYDSLDKFFLTPAEERLLLKQ
YEIYLVDFCRRFDPPMPKCVIGTAFHYFKRFYLNNTPMDYHPKEILATCVFVSCKVEEFN
VSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPYRPVEGFLIDIKTRSNMQN
PNRLRPQIDSFIDLTFFTDACLLHTPSQIGLAAVLHAASKEQENLDSYVTDLLFVSAREK
LPGLIDAVRKIRMLVKNYQPPDREKVKFIEKKLDKCRNQNNNPDSELYKERLRRLYTDED
DMPGEDAKFHIADVSSDTSAMNISQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtatccgttcagctctcaaaaaagatcatggacatttgcaaacgaggcccaactgcag
gcattccgcgtggagcagaacaccaagtatatcaatgagcatgagagtgaagcagcatct
tacgatagcctggacaagttctttctgacgccggctgaggagcgattgctgctcaaacaa
tatgaaatttatctggttgacttttgtcgacgcttcgatccgccaatgccgaaatgtgta
attggcactgcattccattacttcaagcgattctatctcaacaacacacccatggactat
catcccaaggagatattagctacatgcgtgtttgtctcctgcaaggtcgaggagtttaat
gtctccatcaatcagtttgtgaacaacattaaaggcgatcgcaacaaagccacggacatt
gtgctctcgaatgagctgctgttgattggccaattaaactactacctcaccatacacaat
ccctataggcctgttgaaggtttcctaatagacataaagactcgcagtaatatgcaaaat
ccaaatcgtttgcgtccgcagatcgacagcttcatcgatttaacattctttactgatgcc
tgcttgcttcatacaccatctcagattggtctggctgccgtgctgcatgcggccagcaag
gagcaggagaatctcgacagctatgtgacggatctgctatttgtatcagcgcgtgagaag
ctaccaggtctcattgatgctgtccgcaaaattcgcatgctagttaagaattatcaaccg
cctgaccgcgaaaaggtcaagtttattgaaaagaaattggacaagtgccgaaatcaaaat
aataatccagacagcgagctctacaaggagcgcctgcgtcgcttgtataccgatgaggat
gatatgccgggcgaggatgccaagtttcacatagccgatgttagttcggatacatcagcc
atgaatatcagtcaatga

DBGET integrated database retrieval system