KEGG   Drosophila grimshawi: Dgri_GH16374Help
Entry
Dgri_GH16374      CDS       T01061                                 

Definition
GH16374 gene product from transcript GH16374-RA
Orthology
K06634  
cyclin H
Organism
dgr  Drosophila grimshawi
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dgri_GH16374
  Replication and repair
   03420 Nucleotide excision repair
    Dgri_GH16374
Transcription machinery [BR:dgr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dgri_GH16374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 325 aa AA seqDB search
MYPFSSQKRSWTFANEAQLQAFRVEQNTKYINEHESEAASYDSLDKFFLTPAEERLLLKQ
YEIYLVDFCRRFDPPMPKCVIGTAFHYFKRFYLNNTPMDYHPKEILATCVFVSCKVEEFN
VSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPYRPVEGFLIDIKTRSNMQN
PNRLRPQIDSFIDLTFFTDACLLHTPSQIGLAAVLHAASKEQENLDSYVTDLLFVSAREK
LPGLIDAVRKIRMLVKNYQPPDREKVKFIEKKLDKCRNQNNNPDSELYKERLRRLYTDED
DMPGEDAKFHIADVSSDTSAMNISQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtatccgttcagctctcaaaaaagatcatggacatttgcaaacgaggcccaactgcag
gcattccgcgtggagcagaacaccaagtatatcaatgagcatgagagtgaagcagcatct
tacgatagcctggacaagttctttctgacgccggctgaggagcgattgctgctcaaacaa
tatgaaatttatctggttgacttttgtcgacgcttcgatccgccaatgccgaaatgtgta
attggcactgcattccattacttcaagcgattctatctcaacaacacacccatggactat
catcccaaggagatattagctacatgcgtgtttgtctcctgcaaggtcgaggagtttaat
gtctccatcaatcagtttgtgaacaacattaaaggcgatcgcaacaaagccacggacatt
gtgctctcgaatgagctgctgttgattggccaattaaactactacctcaccatacacaat
ccctataggcctgttgaaggtttcctaatagacataaagactcgcagtaatatgcaaaat
ccaaatcgtttgcgtccgcagatcgacagcttcatcgatttaacattctttactgatgcc
tgcttgcttcatacaccatctcagattggtctggctgccgtgctgcatgcggccagcaag
gagcaggagaatctcgacagctatgtgacggatctgctatttgtatcagcgcgtgagaag
ctaccaggtctcattgatgctgtccgcaaaattcgcatgctagttaagaattatcaaccg
cctgaccgcgaaaaggtcaagtttattgaaaagaaattggacaagtgccgaaatcaaaat
aataatccagacagcgagctctacaaggagcgcctgcgtcgcttgtataccgatgaggat
gatatgccgggcgaggatgccaagtttcacatagccgatgttagttcggatacatcagcc
atgaatatcagtcaatga

DBGET integrated database retrieval system