KEGG   Drosophila grimshawi: Dgri_GH16514Help
Entry
Dgri_GH16514      CDS       T01061                                 

Definition
GH16514 gene product from transcript GH16514-RA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dgri_GH16514
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH16514
Transcription factors [BR:dgr03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dgri_GH16514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1034 aa AA seqDB search
MDDESDDKDDTKRKSRNLSEKKRRDQFNSLVNDLSALITPSNRKMDKSTVLKSTIAFLKN
HNEATDRSRVFEIQQDWKPTFLTNDEFTHLMLESLDGFMMVFSSMGSIFYTSESITAQLG
YLPHELYNMSIYDLAYDLEHEALLNIFLNPTPLIEARQTDINASNQITFYAHLKRGGIEK
VEKNAYELIKFVGYFRNDANLNTGSSSDSQSSNSPTLPRIFQQNPNVEVDKSLVFVGTGR
IQTPQLIREMSIIDPTSNEFISKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYYHFD
DLDSIVACHEELRQTGEGKLCFYRFLTKGQQWIWLQTDYYVNYHQCNSKPDYVVCTHKVV
SYAEVLKQNKKDRKKANKAPTSNSNGSSKCASATATLRDFELTHPNLDSTLLNTTLENLS
NEVDATATDAVDASPMWSAGPAATASHSGPVNPLKTSRPASSYGNISSTGISPKAKRKCY
FYPSRANDSDSTSMSAESVTSRQSLMTHVSSQSQRSRTHHGRERIGKHQQQHHQQQQQQQ
QQQQHQQHQLQHLSHQQLQQQQLQSKMVPVLPLTPSQIVTSNPCSFPQSNYPLASPQIVA
PSFLEPPQYLTAIPMQPVMAPFPVAPVLSPLPLPVPVPVPVSVALPMPMTVQSQSELLPG
TVVMTSTQSQMQDQLQRKHDQLQKLIIQQQEELRIVSEQLLLARYTYLQPVMPMGITAGN
VASATAAAVGSASGINVQRSFHFSGSNAVEPQFNQYGFALNSEQMLNQQDQQMLMQQQQN
LHNQQQHNHHMQQHQQQQSQLQQQQLQQQQFQQLQQQQLQQQQMQLQLQQQQQSQSNMLS
REDMEDIDAFLNLSPLQPLASNNNNNNNTTGNSSSNHNNNNISNAPQNTNEDSLLSYMQM
TTESSPSLNFHMGISDDGSETHSEDNKMMHSSKSQLHQQQQQQQQQQQQQQQQHQQHNQQ
VLQQQQQHQQQQQLLQQSHQHQSNSYFGSNPFQSLSGNQNQSQLPNDLEILPYQMSQEQS
QNLFDSSHTANGSQ
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgacgataaggatgacacgaaaagaaaatcccgaaatctgagcgag
aagaagcgtcgagatcaattcaattcgcttgtgaatgatttgagcgcattgataaccccg
tccaatcgtaaaatggacaagtcaacagtgctcaagtcgacaatagcattcctaaagaac
cacaatgaggcaacggatcgttcgagggtgtttgagatacaacaagactggaagcccaca
tttctgactaacgatgagtttacgcacttaatgctggagtccctggatggcttcatgatg
gtctttagcagtatgggatccatattttacacatcggaaagtattaccgcccagttgggc
tatttgccgcacgaactgtacaacatgagtatctatgatctggcttatgacttggagcac
gaagctctgctcaatattttcctgaatcccacgcctctcatcgaagctcgccagacggac
atcaatgccagcaatcagatcaccttctacgcgcatctgaaacgaggtggaatcgagaaa
gtggagaaaaatgcctacgagctgatcaagtttgtgggttactttcgtaacgatgccaat
ctgaatacgggctccagttcggatagtcagagtagcaactcaccgacgctgcctcgaatc
ttccagcagaatcccaatgtggaggtggacaagagtctagtttttgtgggcacgggtcgg
atacagacgccgcaactgatacgcgagatgagcatcatcgatcccaccagcaatgagttc
atctcgaagcacagcatggagtggaaatttctctttctggatcatcgagcgccgcccatc
attggatacatgccgtttgaggtgctgggcacctcgggctatgattattatcacttcgat
gacctggacagcattgtggcatgccacgaggaattgcgtcagacgggtgagggcaagtta
tgcttttatcgcttcctaactaagggccaacaatggatttggctgcagacggactactat
gtcaactatcatcagtgcaactccaagcctgactatgtcgtctgcacgcacaaggtggtc
agctatgcggaggtcctcaagcaaaacaaaaaggaccgcaagaaggcgaacaaagcgccc
acctcaaattcaaatggcagcagcaaatgcgcctcggccaccgcaacgttgcgtgacttt
gagctgacccatccgaatctggacagcacgctgctcaacaccacgcttgagaatctaagc
aatgaggtagatgccacagcaacagatgctgtagatgcctcacccatgtggtcggcgggg
ccagcggctacggccagtcactctggccccgtcaatccgttgaagacttcaaggcccgcc
tccagctacggcaacatcagctcaacgggcatctcgccgaaggccaagcgcaagtgttat
ttctatccgagtcgagccaatgactcggattccacatcgatgtcggccgagtcagttacc
agcaggcagtccctcatgacgcacgtcagttcgcaaagtcaacgctcccgcacgcatcat
ggacgtgaacgcattggcaagcaccaacagcagcatcaccagcagcagcagcaacagcag
caacagcaacaacatcaacaacaccaactacaacatctcagtcatcagcagttgcaacag
caacagttgcagtcaaagatggtgccagtgttgccactgacaccgtcgcagattgttacc
agcaatccctgttcatttccacagtccaattaccctttggccagcccgcagatagtggca
cccagtttcctggagccgccacaatatctgacagcgatacccatgcaaccggtgatggcg
ccatttccagtggcacccgtgttgtccccgttgccgttgccagtgccagtgccagtgccg
gtatcggtggcgttgcccatgccgatgacggtccaatcgcaatcggaactgctgccgggc
accgttgtgatgacgtcgacgcagagccagatgcaggatcagctgcagcgcaagcatgac
caactgcagaaactgatcatccagcagcaggaagagctgcgcatcgtctccgagcaactg
ttgctggcacgctacacgtatctgcagcccgtgatgccaatgggaattactgccggcaat
gtggcttcagcaacggcagctgccgttggcagtgctagtggcatcaatgtgcaacgcagc
ttccatttcagtggcagcaacgctgtggagccgcaattcaatcaatatggttttgcgttg
aactcggagcagatgctgaatcagcaggatcagcagatgttgatgcaacagcagcagaat
ctgcacaatcagcagcagcacaatcatcatatgcaacagcatcagcaacagcagagtcag
ctgcaacagcagcagctgcaacagcaacaatttcaacagctgcagcagcagcagctgcaa
cagcaacaaatgcagctgcaattgcagcaacagcagcagtcgcagagcaacatgttgtcg
cgtgaggatatggaggatattgatgcatttctcaatctatcgcccctgcaaccgcttgca
agcaacaataataacaacaacaataccacgggcaatagcagcagcaaccacaacaacaac
aacatctcgaatgcgccacaaaatacaaatgaggattcgctgttgtcctacatgcaaatg
accaccgagtcgagtccttcgctcaacttccacatgggcatcagtgacgacggcagcgag
acgcacagcgaggacaacaaaatgatgcactcatccaagagtcaactgcatcaacagcag
caacagcaacagcagcagcaacagcaacagcaacaacagcaccagcagcataatcagcaa
gtattgcaacagcagcagcaacatcagcaacagcagcaattgttgcaacaatcgcaccag
catcaatcgaacagctatttcggctcgaatccatttcaatctctaagcggcaatcagaac
caaagtcagctgcccaacgatctggagatattgccatatcaaatgtcgcaggagcaatcg
cagaatctgttcgattcgtcgcacacggccaacggcagccaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system