KEGG   Drosophila grimshawi: Dgri_GH16518Help
Entry
Dgri_GH16518      CDS       T01061                                 

Definition
GH16518 gene product from transcript GH16518-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dgr  Drosophila grimshawi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dgr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dgr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dgr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dgr00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 670 aa AA seqDB search
MPAEKSIFNPNPAISRNAYISSFEEYTKFYQESLDNPAEFWSRVAKQFHWETPADPTKFM
QYNFNISKGPISIKWMDGASTNICYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGVQKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQ
DNHVEQDIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGDAPVLKHNLSGLKVLGSVGEPINPEAWLWYY
RIIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGAASFPFFGVKATLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPIKGECLYCFITPNENEPFDQKLIADL
KKMVRERIGPFAQPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVETK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggaaaaatcaatattcaatccgaatccggcaattagccgcaatgcttacata
tccagttttgaggagtacacgaaattctatcaggaatccttggacaatccagcggagttt
tggtcgcgtgtcgctaaacaattccactgggaaacgcccgcagatcccacgaaattcatg
caatacaatttcaatatctccaaaggaccaatctcaattaaatggatggacggcgcctcg
accaacatctgctacaatctcctagatcggaatgtgcgcaacggactcggagatcagata
gcttactactgggagggcaatcacccggatgattattcacgtggactcacctaccgcaaa
ctgctcgaagaggtttgtcgcttcgccaacgtgctgaaggatcatggagtgcagaagggc
gatcgcgtctccatctatatgcccatgatcctggagctgcccattgcgatgctggcctgc
gctcgcatcggcgccgtccattcgattgtgtttgcgggcttctcgcccgattctttggcg
gagcggatgttcgattgcaaggcgaaactgctgattacggccgatggggcttggcggggc
gagaaaccgctgtacctgaaggccctgtgcgatacggcactggaaaaggtcgaggagatg
ggccactcggtggagaagtgcattgtggtgtcgcatctgaagcgtgtgacaccctgccag
gataatcatgtggagcaggacattccatggaccgatgatcgcgactactggtggcacgag
gagatggaggacaaggagcccgcctgctatcccgaatggatggatgccgaggatccattg
ttcatgctctacacgagtggatccaccggcaagcccaaaggtgtgctccacaccacagct
ggctatcttctgtatgcggcgaccacattcaagattgtgtttgactacaagcccggtgac
atctactggtgcacggccgatgtcggctggatcaccggacacacctacgttgtctatggg
ccactggccaatggcgccacttcggttatcttcgagggcactccattctttccgggcaat
gatcgctactggagcgtcatcgacaagtataaggtcacccaattttatacggctcccaca
gcgattcgggcgctcatgaaatttggcgatgctccggtgctcaagcacaatctttccgga
ctcaaggttttgggcagcgttggtgagccaattaatccggaggcttggctgtggtattac
cgcatcattggcaaggagcagtgctccattgtggacacattctggcaaacggagactggt
ggacatgtcattacgcccctaccaggtgccacgcccatgaagccgggcgctgcttcgttt
ccgttctttggcgtcaaggccacgctgctggacgagtgcggcattgagatcaagggcgag
ggcgagggctacttggtgttctcgcagccctggccgggcatgatgcgcactctgtacaac
aatcatgagcgcttcgaggatacatatttctccaagttcccgggctactattgcaccgga
gacggtgcccgtcgcgatgctgatggttatttgtggataactggccgcgtggatgacatg
ttgaacgtgtccggtcatctgatgtcaactgccgaggtggagtctgttctcacggagcat
ccacgtgtcgccgaatcggctgtggtctctagaccccatcccattaaaggcgagtgcctc
tactgcttcatcacgcccaatgagaatgagcccttcgatcaaaaactaattgccgacctc
aagaagatggtgcgcgaacgcatcggaccctttgcccagccggatgtcatccaaaatgca
cccggattgcccaagacgcgctccggcaagataatgcgtcgtgtgctgcgcaagattgct
gtcaacgatcgcaatgtgggcgacacatccacactggccgacgagcagattgtggagcag
ctgttcgccaatcgtcccgtagagaccaagtaa

DBGET integrated database retrieval system