KEGG   Drosophila grimshawi: Dgri_GH16544Help
Entry
Dgri_GH16544      CDS       T01061                                 

Definition
GH16544 gene product from transcript GH16544-RA
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dgri_GH16544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 762 aa AA seqDB search
MSSKEWKRVVKLEYMKIRQQKRYKRADEIKEAWIKNWDEHNHNVQDLYCESKVWQAKPYD
PPHVDCVKRAEVTNYNGGNSGPQRVPICVINAVTPIPTMYTWAPTQQNFMVEDETVLHNI
PYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSHSKELEETVT
SPTIKTETITCKTLEEEEKKEPPAEVETTPTTSSAASSAAASATVAADDNNKDVEDKDVE
DKKDVDVSAATETQPKVEETKEKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQD
PERPQECTPNIDGTKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYP
ELKTFVEPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNPEI
GKDNGIAVNSAEINSIMAGMMNITSTQCVWTGADQALFRVLHKVYLKNYCAVAHNMLTKT
CRQVYEFAQKEAAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVCNYTP
CDHAGPCDENCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPD
LCQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGE
IISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTG
DHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaaggaatggaaacgcgtggtcaagttggagtacatgaaaatccgtcagcaa
aagcgctacaaacgtgccgatgaaatcaaggaggcatggattaaaaactgggacgaacac
aaccacaatgtgcaggacttgtactgcgagtccaaagtgtggcaagcaaaaccctacgat
ccaccgcacgtggactgtgtgaagcgcgccgaggtaaccaactataatgggggcaacagt
gggccgcagcgagtgcccatttgtgtgatcaacgctgtcactcccatacccacaatgtac
acatgggcgcccactcagcagaacttcatggtcgaggatgagacggtgttgcataacata
ccgtatatgggtgatgaggtgctcgataaggatggcaagttcatcgaggagctcataaag
aactacgacggcaaagtgcacggcgacaaggatccatcgttcatggacgatgccatattt
gtggagttggtgcatgcgctgatgcgttcgcatagcaaggaattggaggaaactgtgacc
agtcccacaatcaaaacagagactataacatgcaagacattggaggaagaggagaaaaag
gagccaccagcagaggtggagacaacgccaacaacttcttcagctgcctcctctgctgct
gcttctgctactgtggcagctgatgataacaataaggatgtcgaggacaaggatgtggag
gacaagaaggatgtggatgtgtctgctgcaacagaaacacagcccaaagtggaggaaacg
aaagagaaactaccgtttccggcaccaattatattccaggcaattagcgccaattttccg
gacaagggcaccgcccaggagctaaaggaaaagtacattgagctcaccgagcatcaggat
ccggagcgaccgcaggagtgcacgcccaacatcgatggcaccaaggcggagagtgtttcc
agggagcgcacgatgcactcatttcacacgttgttctgtcgtcgctgcttcaaatatgat
tgtttccttcatcgtttgcagggacatgctggtcccaatctgcagaagcgacgctatccc
gaattgaagacctttgtggaaccctgcagcaactcctgttacatgttgattgatggcatg
aaggaaaagctggcagccgatagcaaaacgccgccgattgactcttgcaacgaggccagc
tcagaggacagtaatgatagcaacagccagttcagcaacaaggatttcaatcccgaaatt
ggcaaggataatggcatagcggtcaacagcgctgagattaactccattatggctggcatg
atgaacattaccagcacgcagtgcgtgtggactggtgccgatcaagcgctcttccgggtg
ctgcacaaggtgtatctgaagaactattgtgctgtggcgcacaatatgctgacaaagacc
tgccgccaggtgtacgagtttgcgcagaaggaggcagccgagttcagttttgaggacttg
cgtcaggactttactccgccgcgcaaaaagaagaagaagcaacgtctgtggtcgctgcat
tgccgcaaaatccagttgaaaaaggactcgtcctcgaatcatgtgtgcaactatactccc
tgcgatcacgccggtccctgcgacgagaactgctcgtgcatacagacccagaacttttgc
gagaagttctgcaactgcagcagcgattgccagaaccgattccctggctgtcgctgcaag
gcgcagtgcaacaccaagcaatgcccttgctatttggctgtcagagagtgtgacccggat
ttgtgtcaggcttgtggtgccgatcaattcaagctgaccaaaatcacttgcaagaatgtg
tgcgttcagcgtggattgcataaacatttgctgatggcaccttccgacattgctggttgg
ggcatttttctgaaggagggcgcccagaaaaatgaattcatatccgagtactgtggcgag
atcatatcgcaggatgaggccgatcgccgtggcaaagtgtatgacaaatacatgtgctca
tttctgtttaatttgaataacgattttgttgtggatgccacacggaagggcaacaaaatt
cgatttgccaatcattcaatcaatcccaattgctatgcaaaggtcatgatggtcaccggt
gatcatcgcattgggatctttgccaagcgcgccattcagccgggtgaggaactctttttt
gactacagatacgggcccaccgagcaacttaaatttgttggcatcgagcgtgaaatggaa
atcgtttaa

DBGET integrated database retrieval system