KEGG   Drosophila grimshawi: Dgri_GH16633Help
Entry
Dgri_GH16633      CDS       T01061                                 

Definition
GH16633 gene product from transcript GH16633-RA
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH16633
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   Dgri_GH16633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 698 aa AA seqDB search
MTIKPVSAPAGKRVVDADASDAHAAGQVVAIEQSVVNQTHRNVVIDGHGQSPQRRGEVYD
ELTRTHRCSPHKSTRSKRREHLESHAHHHKRDRLEREKLNLNHPAVVGGNAAGVTSKCSS
SPHSSAVAAVAAATATGNSSPTIAVGRKSPEHLGLGCANVPKTQQAQLSPAAGGSQLKAD
EETFSGYNSGDEHSQPKERTISVEEWQRRDEEFAKCMEKRGYELKPVEEDGACLFRSISL
QIYGDEGMHDVTRQHTMDYIHENREYFGQFVTEDINGYIQRKRARDAHGNHIEIQAISEI
YSRPVEVYCYQSTPINIFNSEQSQAGYPPLRLSYQRGSHYNAILDPYNATVGVGLGLAGY
KPEIQTKEAVRLSEQLEIEQTMFEDKLKTTDWEATNEAIEEQIARESYLQWCRDNMQRSG
SNNTAAGSATSSTVTSAEALTDSDASPSKYSSDGGGGGGGGGGIGGSSSVTGSNTNAKSA
AATLSSSSSSVDDEGPATVGFTLSPKTLSQFTHKLPSEVNELGGYDSDATDMSSTSSVGH
CGGNSSPNTAATASQRSSSTSSSSKLSKSQRRSNGLRGSKKRRHEAREAANNSVVEVLET
PQRKSPKRDAAAAPTTPPRAHTPEAEQRPCTSKQSSQSPPKRVDAAQSPAKQSYSSFYQE
LLEASYEGVNESEMLQRAIQLSTRDYMDDQKRKYLGGP
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaagccagttagtgcgcccgctggcaagcgtgtcgtcgatgcggatgccagt
gatgcccatgccgctggtcaggtggtcgctatcgagcaatcggttgtcaatcaaacccat
cgcaatgtcgtcatcgatgggcacggacagagtccacaacggcgtggtgaagtctacgat
gagctaacgcgcacacatcgctgcagtccacacaaaagcactcgctcgaagcgtcgcgaa
catctcgaaagccatgcccatcatcacaaacgcgatcgtttagagcgcgagaaactcaac
ctaaatcatccggctgttgtgggtggcaacgctgccggcgtcaccagcaaatgcagcagc
agtccacactcatcagcggtggcagctgtcgctgctgccacagccacaggcaacagcagt
ccgaccatcgccgtgggtcgcaaatcacccgagcatttgggtctgggctgtgccaacgtg
cccaaaacacagcaggcccaattatcgccagccgctggggggagtcagcttaaggccgac
gaggagacattctctggctataatagcggcgatgagcattcccagcccaaagagcgcacc
atttcagtcgaggaatggcagcgacgcgacgaggagttcgccaagtgtatggagaagcgc
ggctacgaactgaaaccggtcgaggaggatggcgcatgcctctttcgctccatatcgcta
caaatctacggggatgagggcatgcacgatgtcacacggcagcacaccatggattatatt
catgagaatcgcgagtattttggtcagtttgtaactgaggacatcaatggctacatccag
cgtaaacgggcacgcgatgcacatggcaatcacatcgagatccaggccatttcagagata
tacagtcgccccgtcgaagtctactgttatcagtcgacacccatcaacatcttcaattcg
gagcaatcgcaagctggttatccaccactgcgtctatcctatcagcgaggctcacactac
aatgctatactggatccgtacaatgccactgtcggagtcggcttgggcttggctggttac
aagcccgagattcagaccaaggaggcagtgcgtctcagcgaacagctcgaaattgaacag
accatgttcgaggataagctaaagactacagactgggaagccaccaatgaggccatcgag
gagcaaatcgcacgcgaatcctatttgcaatggtgtcgtgataatatgcaacgttcgggc
agcaacaacacagccgccggctcggccacatcgtcgacagtgacgtcggcagaggcgctt
accgattcggatgcctcgccctccaaatactcaagcgatggaggaggtggcggcggaggt
ggtggcggcatcggcggcagtagcagtgtgaccggcagcaatacaaacgccaaaagtgct
gcagctacgcttagcagctcctcctccagcgtcgatgatgagggcccagccacggttggt
tttacgctgtcaccgaaaacgcttagccagtttacgcacaagctgccgtccgaggttaac
gaactggggggctacgatagcgatgccacggacatgagcagcaccagctctgtgggccac
tgcggtggcaattcctcgcccaacacagcagcaacagcatcacaacgctcttcctccacc
tcctcctccagtaaattaagcaaatcgcagcgtcgcagcaatgggctgcgcggcagcaag
aaacgtcgccatgaggcacgtgaggcagccaataatagtgtggtggaagtgctggagacg
ccgcagcgcaagagtcccaagcgtgacgcggcggcggcaccaacaacaccgccgcgtgca
cacaccccggaagcggaacagcggccatgcacctcgaagcagtcatcgcagtcgccgcca
aagcgtgtcgatgctgcacaatcgccggccaaacagagctattccagtttctatcaggag
ctgctcgaagcctcctacgagggcgtcaatgagagcgagatgctgcagcgagccatccaa
ttatccacacgcgattatatggatgatcagaagcgaaagtatttgggcggaccgtag

DBGET integrated database retrieval system