KEGG   Drosophila grimshawi: Dgri_GH16634Help
Entry
Dgri_GH16634      CDS       T01061                                 

Definition
GH16634 gene product from transcript GH16634-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dgr  Drosophila grimshawi
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dgri_GH16634
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Dgri_GH16634
Glycosyltransferases [BR:dgr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dgri_GH16634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 928 aa AA seqDB search
MNSSSSSNRQLRRRFDYVLSQCASRSSASESANLRRKATRSKSKQQQQQNVIEHQNEQNE
RLHFRSRSATSVAAATTTEAITAASASVNCNSPSPLCCNGMLPTAAANMLNCCCRDFNCH
LNTSLGLQLRGSVESHRRSESRQSFLTESSKASQSAATPTSASQKSRSRSRSCSCDDDDD
CGDSAANVVDRLKSQSGDIESNAATATQLTVSLHIDLISWALFLLAFLTRFYKLATPPNV
VFDELHYGKYISHYMRNIFFFDQHPPLGKQLIAGLVSFAGYDGNYTFSRIGATYAPNVPI
FWLRFLPALCGSLLAPAVYKLLLQAQLRRWAASLGGLLIVLDNALLTQSRFVLMESMLLL
ASTVGIACLLRFQRCSLGSLNWLCSGASAALFLACAGCVKYVGFLALALAGYLLCRHLWN
LLYDATLTTRQLWLHALSRLLLFVGIPVAVYLGVFYVHLRTLHRAGPHDSIMTSAFQASL
EGGLASITQGQPLAVVHGSQITLRHTHGRTCWLHSHAAVYPVRYKDQRGSSHQQQVTCYS
FKDVNNWWIVKRPDRDDLVVGDQPDVIGHGDVIQLVHGITSRALNSHDVAAPMTPQCQEI
SCYIDYEIKMAGELLWRVEILNRQTEGDRWHAIKSEIRLIHESTGAALRFSGRQLPSWGF
NQHEVVGDRDQVHQDAIWNVEEHRYTKTQDQRERERQLLSAEMIPTKRTKLSFWAKWLEL
QTKMFWQAKQVQSHMYSSQPHEWPLLDKGIAYWLDDGSSAQIYLLGNVLIWYMASAGLLI
YAGLLIFYALRRRRLCFDISAVEWRRFLIAGDTFFVGYLMHYLPYFFVDRTLFLHNYLPA
FVFKLLLLCYVLEHLEYLLRRHCNAVRGMQLVRLYRFVLLLWLFAVVGIFVKFLPLSYGS
KKMSAKEIIDLRWKDTWDFILQKNYALT
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcagcagcagcagcaacaggcagctgcgcagacgctttgactacgtgttgagt
cagtgcgcgtcgagatcttcagcgagcgagtcggcgaatttgcgacgcaaggcgacacgc
tctaagtcgaaacagcagcaacaacagaatgttatcgaacatcaaaatgagcaaaacgaa
agacttcactttcgcagccgttcagcaacctcagtcgcagcagcaacaacaacagaagca
atcacagcagcgtcagcatccgtcaattgcaattcaccttcaccattgtgctgtaatggc
atgctgcccaccgcagcagcgaacatgctcaactgttgttgccgagacttcaactgccat
ttgaatacatcgctaggactgcagctgcgcggcagcgttgaaagccatcgacgctccgag
agtcgccaatcgtttctaaccgagtcgtcaaaggcgtcgcagtcagcagcaacacctacc
tctgcgtcgcaaaaatcccgttcacgttcgcgttcatgttcttgtgacgacgacgacgac
tgcggcgattcggcggccaatgttgttgatcgtctgaagagtcagagtggagacattgaa
agcaacgctgcgacagccacgcaattaaccgttagcctgcatatcgatctcatcagttgg
gctctctttctgctggcgtttctcacgcgtttctacaagttggcaacgccgccaaatgtg
gtttttgatgaactgcactacggaaaatatatatcgcattatatgcgcaacatattcttc
ttcgatcagcatccgccgctgggcaaacaattgattgctggtctggtcagttttgccggc
tacgatggcaattatacgttttcacgcattggcgccacctatgcaccaaatgtgcccatt
ttctggctacgttttctgcccgccctctgcggcagtctgctcgcaccggcggtttacaag
ctactgctgcaggcgcagctgcgtcgctgggctgcttcgctgggcggcctactcatcgta
ctcgacaatgcgttgctgacgcaatcgcgtttcgtcctaatggaatcgatgctgttgctc
gcaagcaccgttggaattgcctgcctgctgcgcttccagcgctgctcacttggctcgctc
aactggctgtgcagcggtgcgtcggctgcgctgtttctagcttgcgccggctgcgttaaa
tatgttggcttcctggcgctggcactcgccggctatctgctgtgccgtcatctctggaat
ctgctctacgatgccacattgacaactagacagctttggttgcacgcattgagtcggttg
ctgctttttgtgggcattccagtggccgtctacttgggcgtcttctatgtgcacctaagg
acactccatcgagccgggccgcacgacagcataatgacgagtgcctttcaggcgtcgctc
gaggggggattggcatcgattacgcagggtcagccgttggctgtggtgcacggttcacag
atcacgttgcggcacacacatggacgcacctgttggctgcactcgcatgccgccgtttat
ccggtgcgctacaaggatcagcggggctcgtcgcatcagcagcaggtcacctgctactcc
ttcaaggatgtgaacaactggtggattgtcaaacggccggaccgtgatgatcttgtcgtc
ggtgatcagcccgatgtcatcgggcatggcgatgtcattcaactggtgcacggcatcacg
agtcgagcactgaactcacacgatgttgccgcaccgatgacgccgcaatgccaggagatt
agctgctacattgactacgagatcaagatggccggtgagctgctctggcgtgtggagatc
cttaacaggcagaccgaaggcgatcgctggcatgccatcaagtcggaaatacgcttgatc
catgagtccacaggtgctgctctaaggtttagtggtcggcagttgccttcgtggggcttc
aatcaacacgaggtggtcggcgatcgggaccaggtgcatcaggatgccatctggaatgtg
gaggagcatcgctacaccaagacacaagatcagagggaacgtgaacgtcaactgctatca
gcggaaatgataccaacgaaacggacgaaactgtcgttctgggccaagtggctggagctg
cagacgaagatgttctggcaggccaaacaggtgcagagccacatgtacagctcccagccg
catgagtggccgctgctcgacaaaggcatcgcctattggttggatgatgggtccagtgcc
cagatctatttgcttggaaatgtgctcatctggtatatggccagtgctggattgctcatc
tatgcgggcctgctcatcttttatgcgttgcgccggcggcgattgtgttttgatatctca
gcggtggagtggagacgtttcctcatcgctggcgataccttctttgtgggctatttaatg
cattatttgccgtatttctttgtggatcgcactctgttcttgcacaactatttgccggca
tttgtgtttaagctgctgctgctttgctatgtgctggagcatttggagtatctgttgcga
cgacattgcaacgctgtgcgtggcatgcaattggtgcgtctttatcgtttcgtgctcctc
ctttggctgttcgccgttgtcggcatctttgtcaaattcttgccattgagctacggttcc
aagaagatgtccgccaaggaaatcatcgatttgcgctggaaggacacctgggactttata
ctccaaaaaaactatgccctcacctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system