KEGG   Drosophila grimshawi: Dgri_GH16673Help
Entry
Dgri_GH16673      CDS       T01061                                 

Definition
GH16673 gene product from transcript GH16673-RA
Orthology
K04437  
filamin
Organism
dgr  Drosophila grimshawi
Brite
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH16673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 273 aa AA seqDB search
MFKVSQELRLNASAAGNVGQGVGGCDATDGNSPESVCIFGRYQRTPDADAYPTEPPNVYI
APELTDARKVQLLHLPSGAVRINSTASFIIKRNGVKGNFDVRLESPSGQHGCPLELLQLD
PERFQVQCHLPQAGLYKVHIKCNSVPLPKSPFIIVTIAGAPLAEAGTETTAASPAMPTFE
SDASRVQSRGLGLTHVNLLERNEFTVDGSAAGSNMLFVGILGPQGPCDEVLLKHLGRNIY
RVTYQVRDPGDYILVAKWGDEHIPGSPFSLSAE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagtgtcgcaggagttacgtttaaatgcgagcgcagcgggcaatgtgggccag
ggagtgggtggctgcgatgccaccgatggcaacagtcccgagagtgtttgtatttttggg
cgatatcagcgcacgcccgatgcggatgcatatcccacagagccgccgaatgtttacata
gcacccgagctgaccgatgcacgcaaggtgcagctgctccatttgcccagcggcgctgtg
cgcatcaattccacagccagcttcatcatcaaacgcaacggagttaagggcaactttgat
gtgcgcctcgagagtcccagcggtcagcatggttgccctttggagctgctgcaacttgat
cctgaacgctttcaggtgcaatgccacctgccacaggcgggtctctacaaggtgcacatc
aaatgcaattctgtgccgttgcccaaatcgccgtttattattgtgaccatagctggggct
cctttggcggaggcgggcacagagacaactgcagccagtccagcaatgcccacctttgag
tcggatgccagcagagtgcaaagtcgtggtttggggctgacacacgttaatcttctcgag
cgaaatgagttcactgtggatggaagtgcggcaggcagcaatatgctgtttgtgggcatc
ttgggacctcagggaccctgcgatgaggtgctgctcaagcatttgggtcgcaacatttat
cgtgtcacgtatcaagtgcgagatccaggcgactacatcctggtggccaagtggggtgat
gagcacattcctggatcgccatttagtctcagcgccgaatag

DBGET integrated database retrieval system