KEGG   Drosophila grimshawi: Dgri_GH16811Help
Entry
Dgri_GH16811      CDS       T01061                                 

Definition
GH16811 gene product from transcript GH16811-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dgr  Drosophila grimshawi
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dgr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dgr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 493 aa AA seqDB search
MADTKSGRYASSSATISPLVQSPENLECKNFQDYLRTRQTPESLEKLYNYPPICLAVFRE
LPEIARQFVIRILFVDQPVPQAVVSSWGAQRIAKEQMEATSCLTALNVWRVTAIPGGLAA
WELSPTFKKSVRQVLLGGGKPWAMTNTLDKDSKPRDIAFLDTYAMARWRCVLHYMVGTGS
RNGGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFMLQYLET
CEERGFSLPECLSMLFQLSFSTLGRDYSSEGMSHQMLMFLQHLREFGLVFQRKRKEGRFY
PTRLALNVTNKDAAQASTSADDERMQERGYIVVETNYRVYAYTDSQLQVAVLGLFTELLY
RFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMKLVESAIQSKSCLPPTVVDQ
IKLWELERNRFTYTEGVVYNQFLSQTDFVTLRDYAQSINMLVWQNERTRTMVVQKNGHDD
VKRYWKKYSKSGG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgaagtctggccgttatgcgagcagcagtgcaacaatatccccgctagta
cagagccccgagaatttggagtgtaaaaactttcaagactatctacgcacacgtcaaaca
cccgaatcactggagaagctttacaattatccacctatttgtctggccgtctttcgcgag
ctgcccgaaattgccagacaatttgtaatacgcatactgtttgtcgatcaaccagttccc
caggccgttgtcagctcatggggcgcacagcgtattgccaaggagcaaatggaagccacc
agctgcctgactgctttgaatgtttggcgcgtcacagccataccgggcggcctggctgct
tgggagctgtcgcccacatttaagaagagcgtgcgtcaggtgctgctgggcggcggcaag
ccatgggcaatgaccaatacgctggacaaagactccaaaccgcgcgacattgcgttcctc
gacacatacgcgatggcccgctggcgctgtgtgctccactatatggtgggtacgggcagt
cggaatggcggcaccgatgccgaggccattagtccggatgctgtacgcattctgttgcat
gccaatctgatgaagcgcgatgaacgcgatggcatcaccatcacacgtcagggatttcag
tttttgctgctggacactcgcgctcaggtctggcattttatgttgcagtatttggagact
tgcgaggagcgcggcttttcactgcccgaatgcctatccatgcttttccagctgagcttc
tcgacactgggacgcgactatagctcggagggcatgagccatcaaatgttaatgtttctg
cagcatctccgcgagtttgggctggtgttccagcgaaagcgcaaggagggtcgtttctat
cccacacgactggcgcttaatgtgaccaacaaggatgcggcgcaggcttccacatcggcg
gatgatgagcgcatgcaggaacgaggctacattgtggtggaaacaaactatcgcgtttac
gcctacacagactcacagctgcaggtggctgtgctgggactgttcaccgagctcctgtat
cgctttcccaatctcgttgtgggtgtccttacacgcgactcggtgcgtcaagcgctgcgt
ggcggcattactgcggagcaaatcgttagctatttggagcagtatgcacatcccaacatg
aaactggtcgagtccgcaattcaatcaaaatcctgcctgccgcccactgtcgtggatcaa
ataaaactctgggaattggaacgcaatcgtttcacctatacggagggcgttgtctacaat
cagttcctctcacaaacggactttgtcacgttacgcgactacgcgcagtccatcaacatg
ctggtgtggcagaatgagcgcacacgcaccatggtggtgcagaaaaacgggcacgacgat
gtcaaacgctattggaagaagtactcaaagagtggcggctag

DBGET integrated database retrieval system