KEGG   Drosophila grimshawi: Dgri_GH16844Help
Entry
Dgri_GH16844      CDS       T01061                                 

Definition
GH16844 gene product from transcript GH16844-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dgri_GH16844
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH16844
Transcription machinery [BR:dgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dgri_GH16844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 823 aa AA seqDB search
MSGGPAITLKSQPIDGSNSNSGNAAAQQQQQQQQSGNGSAAAAASASSSSSQQSSAAGSS
VPPAQEGTRQNSLQRIQQRKQKVFNLPEAQKFAKLSMYSACQAEGCRCTGWKTPQENRHR
DVESSYCPELSEECRNASCRHPLRSHIAHMAQISRTSMDELLGAIIDMENLFMSMQRVED
DDTKKVYLYLFRLLRQCVLTRTQAVIRGPLGDPPFESPCITKAVLSLVFYKYHHLSSTEL
QTMTEVAKTFLNFLNHYNFESPSARRGDLTLTHEDASTYKINYTRWLVFCHVPAFCNSLR
QFETSLVFGRTLLRTVFQYMSQQLKKKCISERDRFPEDKRSIITQMPKFLEALRSELLKD
DSPIWDPNYRPPNSFVMQQRKRHQELPPTSTITSASSTSTSAASSGKRSSVGEPLQKRIK
KEMPERSISTENQDDLPADVVTRAMKAVAESKTTNKSEILFPVNVSRDENVKAEEQKRAI
EFHVVGNAVTKPVGKQTILWLLGLQLVFAHQLPEMPREYISQLVFDTKHKTLALIKENQP
IGGICFRPFPTQGFTEIVFCAVTMAEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAI
GYFKKQGFSKDIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRHQSEILKELI
AQRHNDVQKVRPGLTCFKEGVPSIPVESIPGLREIGWKPQMRPVRASRPLEESSDPEKLV
TSFASVLQSVRQHTTAWPFLRPVPANEVPDYYDHIKFPMDLKTMGERLKKGYYQTRRLFM
ADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccagcaataactctgaagagccaaccaatcgatggaagtaatagcaat
agtggcaatgcagctgcccaacagcagcagcagcaacagcaatctgggaacggatccgcg
gcagccgccgcatccgcatcatcatcatcgtcccagcagagttcagcagctggatcaagt
gtgccaccagcccaggagggcacccgccagaatagcttgcagcgcatccagcagcgaaag
cagaaggtattcaatctgccggaggcacagaaattcgccaagctctccatgtactctgcg
tgccaagcggagggttgtcgatgcactggctggaagacgccacaggagaacaggcatcgc
gatgttgaatcctcgtactgcccggaattgagtgaggagtgtcgcaatgccagttgtcgc
catccgttgcgttcccacatagctcatatggctcaaatctccaggacaagtatggatgaa
ctgttgggcgccatcattgacatggaaaacttgtttatgtccatgcaacgtgtcgaggac
gatgacaccaagaaggtgtatttgtatctgtttaggttgctgcgtcaatgcgtcctaaca
cgcactcaggctgtaattcgcggcccgctcggcgatcctccgtttgagtcgccgtgcata
acgaaggctgtgttatccttggtcttctataagtaccatcacttgagttcgactgaactg
caaacgatgacggaggtcgccaaaacgtttctgaatttcctcaatcattacaattttgag
tcgccatcggcgcgacgcggtgatttgacattgacgcacgaggatgcgtccacctacaag
atcaactatacacgctggctggtcttctgccatgtgcctgccttttgcaactcgctgcgc
caatttgagacatcgcttgtctttggacgaacccttctccgcaccgtatttcagtacatg
tcgcagcagctgaaaaagaagtgcatttcggaacgtgatcgctttccggaggacaaacgt
tcgataattacgcaaatgccaaagttcttggaggcactgcgctcggagctgctgaaagat
gattcacccatttgggatccaaactacaggccacccaattcgtttgtcatgcagcaacgg
aagcggcatcaggagttgccaccgacatcaacaatcacatcggccagctcaacgtccacg
tcggcagccagcagtggtaaacgctccagcgtcggagaaccacttcagaagaggatcaaa
aaagaaatgcccgaacgaagcatcagcactgaaaatcaagatgatctgccagccgatgtg
gtaacgcgtgccatgaaagccgtagccgaatctaagacaacaaacaaatcggaaattcta
tttccggtaaatgtgtcgcgcgatgagaatgttaaagctgaggagcagaaacgggccatc
gagtttcatgtggtgggcaatgcggtgacaaagcccgtgggcaagcagacaatcctatgg
ctactaggattacagctggtgtttgcgcatcagctgccggagatgccgcgggaatatatc
agtcagctggttttcgataccaagcataaaacgctggcactcatcaaggagaatcagcca
attgggggcatttgctttcgcccatttccaacgcagggcttcacagagatcgttttctgt
gcagtgacaatggcggagcaggtgaagggatatggaactcatctgatgaatcacttgaag
gattacagcattcagcgtggcattaagcatttgcttacgtttgccgattgtgatgccatt
gggtatttcaagaagcagggattttccaaggacatcaaattggcacgacccgtctatgct
ggctacatcaaggagtatgatagtgccaccctgatgcactgtgaactgcatccaagtatt
gtgaacactcagtttatagccgtgattcgccatcaaagtgaaatcctgaaggagctcatt
gcacaacgtcataatgatgtccagaaagtcaggcctggcctaacatgcttcaaggaaggt
gtgccctccatcccagttgagtccataccgggcctgagggaaatcggttggaagccacaa
atgcgtccagtgcgcgcatctcgtcccctggaagagtcatcagatccggaaaaacttgtc
acatcctttgcatcagtattgcaatcggtgcgtcagcataccacggcttggccattttta
cggccggtgccggcaaacgaggtgcccgactactatgatcatatcaaatttcccatggac
ttgaaaacgatgggcgagcgcctaaagaagggttattatcagacacgccgcctgttcatg
gcagatatggcacggattttcagtaattgtcggttctacaattcacccgacacggagtat
tatcgttgcgccaattcgctggagcgttatttccaaaccaaaatgcgtgaactgggctta
tgggacaaatga

DBGET integrated database retrieval system