KEGG   Drosophila grimshawi: Dgri_GH16892Help
Entry
Dgri_GH16892      CDS       T01061                                 

Definition
GH16892 gene product from transcript GH16892-RA
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dgr  Drosophila grimshawi
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dgri_GH16892
Enzymes [BR:dgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dgri_GH16892
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dgri_GH16892
  Exosomal proteins of colorectal cancer cells
   Dgri_GH16892
  Exosomal proteins of bladder cancer cells
   Dgri_GH16892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 493 aa AA seqDB search
MKFLICALLAASYVAAADIKLEEGVIVGTVDNFKQVIAENEFVLVEFYAPWCGHCKALAP
EYAKAAQQLAESESPIKLAKVDATVEGDLAEQYAVRGYPTLKFFRSGAPVEYNGGRQAAD
IVAWVTKKTGPPAKDLTSVAEAEQFVKDNEIAIIGFFKDAESEEAKTFTKAANALDSFIF
GISSNADVIAKYEAKDNGVILFKPFDEKKSVFEGELTEENLKKFAQVQSLPLIVDFNHES
AAKIFGGSIKSHLLFFVSKEAGHIETYVDPLKEIAKKHREEILFVTISSDEEDHTRIFEF
FGMNKEEVPTIRLIKLEEDMAKYKPETNDLSAESIEAFLKKFLDGKLKQHLLSQEVPEDW
DKQPVKVLVSTNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYEQLAEKYKDNADIVIAK
MDSTANELENIKISSFPTIKYFRKDDNKVIDFNLDRTLDDFVKFLDANGEVAEAETAEES
DEEEEAAPKKDEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcttaatctgtgcactacttgcggcgtcctacgtggcggccgctgatattaaa
ctggaggagggcgtcatcgttggcactgtggataacttcaaacaagtgattgccgaaaac
gaatttgtgcttgttgaattttatgcaccatggtgtggtcactgcaaggcattggcgccc
gagtatgccaaggctgcccaacaactggcggagagcgagtccccgattaagctggccaag
gtcgatgccaccgttgaaggcgatctcgccgagcagtatgcggtccgtggctatcccaca
ctaaagttcttccgcagcggcgcgcccgtggagtataatggtggtcgtcaagccgccgat
attgttgcgtgggtgaccaagaagactggaccaccagccaaggatttgaccagcgtcgct
gaggccgagcagtttgtgaaggacaatgaaatcgccattattggcttcttcaaggatgcc
gagtcggaggaggcaaagaccttcaccaaggccgccaacgcattggactcgttcatcttt
ggtatcagcagcaatgccgatgtgattgccaagtacgaagccaaggacaatggcgtcatt
ctgttcaagcctttcgatgagaagaaatcggtgttcgagggtgagctgaccgaggagaac
ctcaagaaattcgcacaggtgcaatcgctgccattgattgttgacttcaatcatgagtcg
gctgccaagatctttggcggttcgattaagtcgcatctgttgttcttcgtatccaaggag
gctggccacattgagacctatgtggatccattgaaggagattgccaagaagcaccgcgaa
gaaattctgttcgtcaccatctcttcggatgaagaggatcacactcgcatctttgagttc
tttggcatgaacaaggaggaggtgcccaccatccgtttgattaagctggaggaggatatg
gccaaatacaagcccgaaacgaacgatctgtctgccgaatcgattgaggccttcctcaag
aagttcctcgatggcaaactgaagcagcatctgttgtcgcaggaagttcccgaggattgg
gacaaacagcccgtcaaggtgctcgtctcaaccaatttcgagagcgttgctctggacaag
agcaagtctgtcctggttgagttctatgcaccatggtgcggacactgcaaacagctggct
cccatctacgagcagctggccgagaagtacaaggataatgccgacattgtcattgccaag
atggactccactgccaacgagctggagaacattaagatttcatcgttcccaaccatcaaa
tacttccgcaaggatgacaacaaggtgatcgatttcaatctggacaggactctggatgac
tttgttaagttcctcgatgccaatggtgaggttgctgaggccgagacagctgaggagagc
gatgaggaggaggaagcggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system