KEGG   Drosophila grimshawi: Dgri_GH17103Help
Entry
Dgri_GH17103      CDS       T01061                                 

Definition
(RefSeq) GH17103 gene product from transcript GH17103-RA
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH17103
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dgri_GH17103
Transcription machinery [BR:dgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dgri_GH17103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 241 aa AA seqDB search
REHESKSNSASSGTGGGGTNSSSSSSSANANASHCYGQCNCIIDQIFTGMLQSDVVCQAC
NGVSTTFDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQE
STKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFS
LYAVVNHVGTIDTGHYTAFVRHQKDTWVKCDDHVITMASLNQVLESEGYLLFYHKNILEY
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
agagagcacgagagcaagagcaacagtgccagcagtggcactggcggcggcggcaccaac
tccagttcgagttcatcgagtgcgaatgcgaatgcatcgcattgttatggccagtgcaac
tgcatcatcgatcaaatctttacgggcatgctgcagagcgatgtggtgtgccaggcgtgc
aacggcgtctcgaccacattcgatcccttctgggacatctcactcgatctcggcgagaca
acgacgcacggcggcgtcacgccaaaaaccctcatcgattgcctcgagcgatacactcgc
gccgagcatcttggctcggcggccaaaatcaaatgctccacctgcaaatcgtatcaggag
tcgaccaaacagttcagccttcgcactctgcccagcgtcgtctccttccacctgaagcga
ttcgagcactcggccctgattgatcgaaagatctcctcgttcattcagtttccagtcgaa
ttcgatatgactccgtttatgtcggagaagaaaaatgcttacggcgattttcgtttctct
ttatatgcggttgtcaatcatgtgggaacgattgacacgggacattatacggcatttgtg
cggcaccagaaggacacgtgggtcaaatgcgatgatcatgtgataacgatggcgtcgctc
aaccaggttctcgaaagcgagggttatttattattctatcataaaaatatactggaatac
gagtga

DBGET integrated database retrieval system