KEGG   Drosophila grimshawi: Dgri_GH17207Help
Entry
Dgri_GH17207      CDS       T01061                                 

Definition
GH17207 gene product from transcript GH17207-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dgr  Drosophila grimshawi
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dgri_GH17207
   04340 Hedgehog signaling pathway
    Dgri_GH17207
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dgri_GH17207
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dgri_GH17207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 501 aa AA seqDB search
MTTKTCTRFCTPLAGVRKTSASSKLTSGTESKITPSAAVQHKKIPTTTTSSNDSNIETTF
TFKLNRDTVGSDVISSESSDPLESDCSEETEEENLQQKQLQHDKKKIQSKHFSSNIRSSD
STTILSIDNENVTDVDEDTEDDVVDLTNNDDSDKSDQDDGNESDDEETDDESDESSSVQT
AKGIRKYHLDDYKIIKTVGTGTFGRVCLCLDTVSEKYCAMKILAITEVIRLKQIEHVKNE
RNILREIRHPFVISLEWSTKDSTNLYMIFDYVCGGELFTYLRNAGKFTTQTSNFFAAEIV
SALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQ
SKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILNGKIEWERHMDAVAKDLIKK
LLVNDRTKRLGNMKNGADDVKRHRWFKHLNWTDVYNKKLKPPILPEVQHDGDTGNFDDYP
EEDGKPVKVVDQRDLQLFNEF
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaaaacgtgcacgcgcttttgcacgccgttggcaggagtcagaaaaacttcg
gcatcatcaaaattaacttctggaacagagagcaaaataacaccatcggcagcggtacag
cacaagaaaattccaacaacgaccacatcatcaaatgacagcaacatagagacaacattt
acatttaaattaaaccgtgacactgttggcagcgatgtgatctctagtgagtcatcagat
cccttagaatctgattgtagcgaggaaaccgaagaagaaaatctccaacaaaaacaactg
cagcacgataaaaaaaagatacaatcaaaacacttcagctccaacattcggagcagcgac
agcaccaccatactgtcaatagacaatgaaaacgttacggacgtcgatgaggatacggag
gatgatgtagtcgatcttactaataacgatgattctgataaaagtgatcaagacgatggc
aatgaatccgatgatgaggagactgacgatgagtctgacgagagcagcagtgttcaaaca
gcaaagggtattcgcaaatatcatctcgatgattataaaataattaaaactgttggcact
ggaacctttggacgtgtctgtctttgcctagatacggtttccgaaaaatactgtgcaatg
aaaattttggccataacagaagtcatacgtctcaaacaaattgaacatgttaagaatgaa
cgaaatatattacgagaaattcgacatccgtttgtcatcagcttagaatggtctacaaag
gattcgacaaatctatatatgatttttgattatgtttgcggtggtgagctctttacatat
ctgcgcaatgcaggcaagtttactacacaaacttccaatttttttgcagctgaaattgtt
agcgctctagaatacttacactcattgcaaattgtctatcgggacttaaagcccgagaat
ttgttaattaatcgagatggacatttaaaaattactgatttcggctttgcaaaaaagtta
agagatcgcacttggactttatgcggcacgccggagtacatagctcctgaaataatccag
tccaaagggcataacaaggcagtcgactggtgggcgctaggtgtgttaatctacgaaatg
cttgtcggctatccgcctttctatgatgagcaaccttttggcatctatgaaaaaatattg
aatggtaaaattgaatgggaacgacacatggatgctgttgctaaagacttaattaaaaag
ttgttggtgaatgataggaccaaacgactaggtaatatgaagaatggcgctgatgatgta
aaaaggcatcgctggtttaagcacttaaattggactgacgtctacaacaaaaaactcaag
ccaccaattttacctgaagtacaacatgacggtgatactggaaattttgatgattatccc
gaagaggatggcaagcccgtcaaagtagtcgatcaaagagatttgcagttatttaatgag
ttttaa

DBGET integrated database retrieval system