KEGG   Drosophila grimshawi: Dgri_GH17430Help
Entry
Dgri_GH17430      CDS       T01061                                 

Definition
GH17430 gene product from transcript GH17430-RA
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dgri_GH17430
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH17430
Peptidases [BR:dgr01002]
 Metallo Peptidases
  Family M67
   Dgri_GH17430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 419 aa AA seqDB search
MSKAVNNMNMGIVEPLERMKQLSHYGNLIDVDKNMPVTRYYRSGTEMLRMANVYLNEGNH
ENAFILYMRYMTLFIEKIRQHPDYGSVKAEVKAINKTIKDEIMPTTEKLRTKLLAQYQRE
YEQFLANKEAERMREQERERHRQRELANRKAAGSGNVPSLIPANLHVQMDASNQPTAPDL
DLLDQVVYPNDFPTGTNRSNLPNSGLLLPAADASADKTTNSLSKPAFDRNQKPQYNRTDS
LLAGSLRTVNVPGDTMDVFLKLARSNTSNNIETCGVLAGHLARNELYITHIITPQQHGTP
DSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMMPEAIAIVCA
PKYNTTGFFLLTPHYGLDYIAQCRQSGFHPHPNDPPLFMDAQHIHMDGQAKIKVIDLRR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggccgtgaacaatatgaatatgggcattgtggagccgctggaacgcatgaaa
caattgtcccactacggcaatctcatcgatgtggacaagaacatgccagtgacacgctat
tatcgctccgggacggagatgttgcgcatggcgaacgtgtatctgaacgagggcaatcac
gagaatgccttcatcctctacatgcgctacatgacgctcttcatcgaaaagatacgccag
catcccgactatggcagcgttaaggccgaggtgaaggccatcaataagacgattaaggac
gagattatgccaacgacggagaagctgcgcaccaagctcctcgcgcaatatcagcgcgaa
tacgaacagtttcttgccaacaaggaagcggaacggatgcgcgaacaggaacgagaacgt
caccggcaacgggagctggcgaaccgcaaggcagccggatcaggcaatgtgccgtcgctg
atacccgccaatctgcatgtgcaaatggatgcgagcaatcagccaacggcgcctgatctc
gatctgcttgatcaggtggtgtatcccaatgattttcccacgggcaccaatcgcagcaat
ctgcccaattccggtctgttgctgcccgccgccgatgccagcgccgataaaacaaccaac
tcattgtcgaagcccgctttcgatcgcaaccagaagccgcaatataatcgcacggactcg
ctgctggcgggctcgctgcgcaccgtcaacgtacctggcgacactatggatgtgttcctg
aagctcgcccgctccaatacctccaataacattgagacttgtggcgtactcgccggccat
ctggcccgtaatgagctgtatatcacgcacattattacgccgcagcagcacggcacgccg
gacagctgcaacacgatgcacgaggagcagatctttgatgtgcaggaccaaatgcagctc
atcacactaggctggatacatacgcatccgactcagacggccttcctgtcctccgttgat
cttcacacgcattgctcttatcagatgatgatgcccgaagcaattgccatcgtctgtgcg
cccaagtacaatacaactggtttctttctactcacgcctcattatggactggactatatt
gcacagtgtcggcagagcggatttcatccgcatcccaatgatccgccgttgttcatggat
gcccagcacatccatatggatggccaggccaagatcaaagtcatcgatttgcgcagatag

DBGET integrated database retrieval system