KEGG   Drosophila grimshawi: Dgri_GH17457Help
Entry
Dgri_GH17457      CDS       T01061                                 

Definition
GH17457 gene product from transcript GH17457-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dgr  Drosophila grimshawi
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dgr00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dgr00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dgr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 564 aa AA seqDB search
MLKRKSIGLLGAFVLLIAIIGGQAKTVPCKLKDVKYGKVCVCTADYCDYLDNPTLSKDDD
FAIISSSKQGLRFELNTGSFGSKDTYAIEDYVEPASKFAASNDTILSKLWDQAIDSIFSQ
SATPASSITRSVTLKLDRSKRFQKIEGFGGSFTGAVSYLLNNFKEQDIQDHLYKSYYAAD
GLGFNLLRISIGGCDFDLNPWAYNEEPQNEVVLTGMDKLHERDVLRVGQIKRMKEVSGET
NLRIKGAAWSPPKWMKTNNEWTGFGQLKREYYQTWANYHLKWLDLMESNGLPIWAISTGN
EPLNGIFFMFFVKFMSLGWTPQMQAVWLNDYLGPTIRNSKHKDIIIFGNDDQRFTSPLWF
KMMNRTRPNSVDYIDGVALHWYWDEIFGNSFIHKTNKYMENKIQIISESCIGDKPWQKAA
PLLGSWERGEKMARSMMSHLQDGFHGWIDWNIILDEEGGPNYVDNFVDAPVIADTITYTE
FYKQPMFYVMGHFSKLVPEGSVHIEAVASNINLDCIAFIRPDNKIVAVLFNSGRADLDIT
IVDTIRGELKVNVPAKSIHTLYYN
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgcaaaagtatcgggcttcttggagcattcgtgctgctgatagccattatc
ggtggccaggctaagacagttccctgcaagttgaaggacgtaaagtatggaaaggtatgt
gtttgcacggcggattactgcgactatctggacaatcccacgctgagcaaggatgatgac
tttgccatcatttccagcagcaaacagggattacgctttgaattgaacacgggtagtttt
ggatccaaagatacgtatgccatagaggactatgtggagcctgcttccaaattcgcagcc
agcaatgacacgattctgtcaaagttgtgggatcaggctattgacagtattttctcgcag
tctgccactccggctagcagcatcacgcgatccgtaacgctgaagttggatcgtagtaag
cgatttcagaaaattgaaggatttggaggtagcttcacaggagctgtgtcctacttgttg
aataacttcaaggaacaggatattcaagatcatctctacaagtcatattatgccgccgac
ggtctgggtttcaatttattgcgtatttcgattggaggttgtgattttgatttaaatccg
tgggcctacaacgaggaaccccaaaatgaagttgttctgaccggcatggacaagctgcat
gaacgtgatgttttacgtgttgggcagatcaagcgcatgaaagaagtgtctggcgaaaca
aatctccgtataaagggagcagcgtggagtccaccgaaatggatgaaaacaaacaatgaa
tggaccggcttcggacaactgaagcgagagtattatcagacctgggctaactaccatctt
aagtggctggatctgatggagagcaatggtctgcccatctgggccatttccactggaaac
gagccgttgaacggaatatttttcatgtttttcgtcaaatttatgagcctcggctggaca
ccacaaatgcaggctgtttggttgaatgattatctcggacccacaattcgcaattcaaag
cacaaggatatcattatattcggcaacgatgatcagcgtttcaccagtccgctttggttc
aaaatgatgaatcgcacacgccccaattcggtggactatattgacggtgttgccttgcac
tggtattgggatgaaatatttggtaacagttttattcataaaactaacaagtatatggag
aataaaatccaaatcatctctgaatcctgcatcggtgacaagccctggcaaaaagcagct
ccattgctgggcagctgggaacgaggagaaaagatggcacgttcaatgatgtcccatctg
caggacggtttccatggctggatcgactggaacatcatactggatgaggaaggtggaccc
aactatgtcgataattttgtggatgctccagttattgccgacacaataacctacactgag
ttctacaaacagcccatgttttacgtaatgggccatttctccaagctggtgcctgaaggc
tccgttcacatcgaggcagtggccagcaatatcaacctcgactgcattgccttcattcga
cccgacaacaagattgttgccgtgctcttcaatagtggtcgtgccgatctggacattacc
atagttgacaccatacgcggcgaactaaaagtcaacgtgccggcaaagtccatacataca
ctgtactataactaa

DBGET integrated database retrieval system