KEGG   Drosophila grimshawi: Dgri_GH17458Help
Entry
Dgri_GH17458      CDS       T01061                                 

Definition
GH17458 gene product from transcript GH17458-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dgr  Drosophila grimshawi
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dgri_GH17458
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dgri_GH17458
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dgri_GH17458
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dgri_GH17458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 548 aa AA seqDB search
MHSFAAAALSTPCQLRETNYGSVCVCNSSYCDYLEQPELNDNVHIVAISSSKSGLRFKRF
DGSFLDKVFEVQDYQSVDENFVADSIVVEQNKAWLQLANIPQRFAFNVSIKTVQLTVKRE
QRFQKITNFGGAFTGSVSHIIQQLPTDLQDHIYRSYFHQDGIGYNSVRMSIGGSDFDLQP
WAYNELPRNDHSLSNFTTLDSRDLQKIEQLKRLKSVGRLNDLKIMAAAWSAPTWMKSNDR
WTGFGQLKSEYYQTWAEYHLKFLELMQSKNMSVWAISTGNEPLNGVIGFFFVHFMSMGWT
PWQQAIWLSDYLGPTIKNSSQSHVLIFGNDDQRYTYPSWFRKMRSSRTKALDYLDGLAVH
WYWDEVFGPQLIDEAHKEMPDKLILNTESCIGDKPWQTHGPELGSWGRGESYMRAYIQDL
LHSFNGWLDWNLVLDEQGGPNYVQNHVDSPVIVNTTSRTEFYKQPIYYAIGHFSKFVPEQ
SMRIEARTNETESFSQLSAVGFQRPDGSVALILYNGENVPVNVALNDSQRGALILRLPAR
SWHTVIYK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcattcttttgctgcagctgccttatcaacaccctgccagctaagggaaacaaactac
ggcagtgtttgcgtctgcaacagcagctattgcgattacctggaacagcccgaactgaac
gataacgttcatattgtggcgattagctcgagcaagagcggcttgcgttttaagagattc
gatggcagctttctggacaaggtattcgaagtgcaggattatcagtcggttgatgaaaac
tttgtagccgattcaattgttgtagagcagaacaaagcctggctgcagcttgcaaatatt
cctcagcgatttgctttcaatgtcagcattaagacggtgcagctaacggtaaagcgcgag
cagcgctttcagaagataacaaactttggaggtgcttttacgggcagcgtttcgcatatt
atacaacaactgccgactgatctacaggatcatatctatagatcctattttcaccaagat
ggtatcggctacaactcggtacgcatgtcgattggcggctccgactttgatctacagcca
tgggcctacaacgaactgccccgcaatgatcactcattaagcaactttaccacactggat
agcagagatctgcaaaaaattgaacagctgaaacgtctgaaatcagttggtcgtttaaat
gaccttaaaataatggccgcggcttggagtgcgcccacttggatgaagagcaacgataga
tggacgggattcggtcaactaaaatcagaatactatcagacctgggcagagtatcatttg
aaatttctcgaactgatgcagtctaaaaatatgtccgtctgggccatatccaccggcaat
gagccgttaaacggtgtcattggtttctttttcgtacactttatgagcatgggatggacg
ccttggcagcaggccatttggctaagcgattatcttggaccgaccattaagaactcaagt
caaagtcacgtgcttatatttggcaacgatgatcagcgttacacgtatccctcctggttt
cgcaagatgcgctcttctcggaccaaagcactcgactatctcgatggcctggccgtgcac
tggtattgggatgaggtgtttgggccgcagcttatagacgaggcgcacaaggaaatgccg
gataaattgatattaaatacggaatcatgcatcggcgacaaaccctggcagacgcatggc
cccgaactgggcagttgggggcgtggcgagagctatatgcgtgcctatatacaggacttg
ttacacagttttaatggctggctagattggaatctggtgctggacgagcagggcggcccc
aactatgtgcagaatcatgtcgattcaccggtgattgtgaatacaacaagtcgcaccgaa
ttctacaagcagcccatttactatgccatcgggcatttcagcaaatttgtgccggagcaa
tctatgcggatcgaggcgcgcaccaatgaaaccgagtccttttcccagctgagtgctgtg
ggcttccaaagaccggatggcagtgtggcgttgatcttatacaatggcgaaaatgtaccc
gttaatgtggccctcaatgacagtcaacgtggtgcattaattctacgtctgccagctcgc
tcctggcatacggtaatctacaaatga

DBGET integrated database retrieval system