KEGG   Drosophila grimshawi: Dgri_GH17464Help
Entry
Dgri_GH17464      CDS       T01061                                 

Definition
GH17464 gene product from transcript GH17464-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dgr  Drosophila grimshawi
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dgri_GH17464
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dgri_GH17464
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dgri_GH17464
Transcription machinery [BR:dgr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dgri_GH17464
Messenger RNA biogenesis [BR:dgr03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     Dgri_GH17464
Spliceosome [BR:dgr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dgri_GH17464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 302 aa AA seqDB search
MGDVMNIDSIISRLLEVRGARPGKNVQLSESEIRGLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLEKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgttatgaatatcgacagcatcatatcacgacttctggaagtgcgtggggca
cggccaggcaaaaatgttcagctctctgagagcgaaattcgtggcctctgtctgaagtcg
cgagagatatttctctcgcagcccatactgttggagctggaggcaccgttaaagatttgc
ggcgacatacatggccaatattacgatctactacgtctgtttgagtacggcggctttccg
cccgaatcaaattacctgttcttgggcgactacgtcgatcgtggcaaacagtcactggag
accatctgtttgctgctcgcctacaagatcaaatactcggagaacttctttttactgcgc
ggcaatcacgagtgtgccagcataaatcgcatctacggattttatgatgaatgcaagcgt
cgctataccatcaaattgtggaagacattcaccgactgcttcaactgtttgccagtggca
gccattgtggatgagaagatattctgttgccatggtggactcagtcccgacctctcgtcg
atggagcaaatacgtcgcattatgcgacccaccgatgtccctgatcagggcctgttgtgc
gatttgctgtggtccgatccggacaaggacaccatgggctggggcgaaaatgatcgtggc
gtcagtttcacatttggcgccgaggttgtcgccaaatttttggagaagcacgagttcgat
ctcatttgccgcgcccatcaggtcgttgaggatggctatgagttctttgccaagcgtcag
ctggtcacgctcttctcggctccaaattactgcggcgaatttgacaacgctggcgcaatg
atgtctgtggatgagacactaatgtgctcattccagattttgaaaccggctgacaagcgt
aaaaagtaa

DBGET integrated database retrieval system