KEGG   Drosophila grimshawi: Dgri_GH17506Help
Entry
Dgri_GH17506      CDS       T01061                                 

Definition
GH17506 gene product from transcript GH17506-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dgri_GH17506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1238 aa AA seqDB search
MDFLSNLIKRPISIALPENETKTETEIETETETVSSNSSSSAPTSIVASSGTTKPTFTST
SQITLAMNTADLDDLFDSAAQDLDILEEQHKQIIESDVAPLECAAQQPVLKPNYPRETIT
QLLNDINVNLDQVSANEMEHLQAMSLELSPLAVRPSPRHNMDQQKALISALLCPSQPVTP
TTPNSCEQQPVLKFTGLPEYDETQIPELPPLSVDMEAQLKTDAGMPTLSSTVLKVSEPDY
NSDSDVYAECLSLNSVKLSADQSELDAYASALNEVLDHHLSNATATTLENTLSEAATVSS
HNDSCESMDVDDINETMEMLKDVLAPEDCHLLQQQLSSNEMLRQLQIEQVQPVANEQEEL
QHKQVISASNSPKIEQEEMQQMQAVPASNSPKREQEEMQQMQAVPASNSPKREQEEMQQM
QAVPASNSPKTEREEMQQIQAVPASNSPKTEEKQDMHIEQLLQEQTASAPISPPLATMQT
QQTAAVAPTIEEQLVVPPMLPPMLPTSPPIPTHRTRTAEELAELRAMAAFAEPPVTDGGE
QPATTESVEQKQFPASPSLPIASVAPMEIKHTQFPTLTLNITNPTSQENISAPTSPAFPI
KSPAGSPGHFPRSPHAPPEHEEMDYLEQAIIEHSAEQRSIVVGGVIAKSPLPVEVFVSQP
DPEQSKEAEESPLNDTFDSTAEALTVRRRDTYGLPLDDANDQQRRTFTIIEPTESKRRTM
TIAKNASPALEATEANILGDELESMDVDVSMSVDTTLSAEHQATKTPSPSLQREMHSPPM
PTHEQEQQPKQEPLRPSPPLPAHFKRPSIHKEHMLEEQTLSVKEQLSVGDEKDDVYVDHF
GAMSPIPDDIFKAPQFTSSTFSSMARSNNQAAAPVSAAAPADDSTAAAVQFDEAEFHDGA
SNNNSSNNAPIDRSSLLLKFDPLLGAPVPVNQQSQQEQTLHNILSNINNNHKNSNNKNNN
NYNNLTRALSPTLEEHDSSGSNQSGEITKKHAKMSVDVIDNDCNKTFDNSTLNSEDKTHK
YHNMDELEKKIKNEVTRSEDIENKLKEAEQREEALVKRITEKDKNNSKLNGVIEAYEKAI
AELIHDKEQLVQNHERQMLEVQTDRDSNYTHLMSLETTFSDLHVKYEKSKEMTSHLKQIE
ENLLEEKKKVMDKLRQQEQRYEQMKSHAMQQMEIANKKLVTLTKEHTDEVKKLKALLKKE
EVSRISTAEQLQQKSRENADLLKICEELIYDKGQGGSS
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atggatttcctatcgaatcttataaagcgtcccatcagtatagccctgcccgagaacgaa
acaaaaactgaaactgaaatcgaaactgaaaccgaaaccgtgtcgagtaacagctcctcc
agtgcgccaacatcaattgttgcaagcagcggcacaacaaagcccacattcacctctacc
tcacaaataacattagcgatgaatactgcggatctggatgatctgtttgattcggctgca
caggatttggacatcctggaagagcagcacaaacaaattatcgagagcgatgtggcgcca
ctggagtgtgcagcccagcagccggtgctgaagcccaactatccaagggaaaccataaca
caactgctcaatgatatcaatgtgaatttggatcaagttagtgccaatgaaatggaacac
ttgcaggcaatgagtctagagctcagtccattggcggtgaggccgagtcccagacacaac
atggaccagcagaaggcactcatctcagcattgctttgcccctcgcagccggtcacgcct
acaacgcccaacagctgcgagcaacagccagtgttaaagttcaccgggctgcccgaatac
gatgagacacaaataccagaattgccgccactcagcgtcgacatggaagctcaattaaag
acggatgctggtatgccaacactgagctccactgtgctcaaggtcagcgagccggattac
aattcggattcggatgtctatgccgaatgcctctcgctaaacagtgtcaagctctccgcg
gatcagtccgagctcgacgcctacgccagtgctctgaatgaggtgctcgatcaccatttg
tccaatgctacggccaccacactggagaatacgctgagcgaggcggccactgtctccagt
cacaatgatagttgtgagtccatggatgtggatgacataaatgagacaatggaaatgtta
aaggatgtcctcgcacccgaggattgtcacctgctgcagcagcagttgtcctccaatgag
atgttaaggcagctacaaatcgagcaagtgcagccagttgccaacgagcaagaagagctg
caacacaagcaagtaatttcagcttcaaactcacctaaaatagagcaagaagagatgcaa
caaatgcaagcagttccagcttcaaactcacctaaaagggagcaagaagagatgcagcag
atgcaagcagttccggcttcaaactcacctaaaagggagcaagaagagatgcagcagatg
caagcagttccggcttcaaactcacctaaaactgagcgagaagagatgcaacagatacaa
gcagttccggcttcaaactcacctaaaactgaggagaagcaggacatgcatattgagcag
ctgctgcaggagcagacagcatcagctccaatctctccaccattagccacaatgcagacg
cagcaaacagctgcagttgcacccacaattgaggagcaactggtggtgcctccaatgctg
cctccaatgttgcccacctcaccgcccatacccacacatcgcacgcggacagctgaggag
ttggcggagctgagggcaatggcggcatttgcagagccaccagttacagatggaggagag
cagccagctaccacagaatctgtggagcagaagcaattcccagctagtccgagcttaccc
attgcatcagtggcacccatggaaatcaaacacacacaatttccaacgctgacactgaat
ataaccaatccgacgtcgcaggaaaacatttcggcgcccacatcgcccgcttttcccatc
aaatctcccgccggttcaccgggtcactttccacgctcgccgcatgcgccgcccgagcac
gaggagatggactatttggaacaggccatcattgagcactcggctgagcagaggtcgatt
gttgtcggtggcgttatagccaaatcaccgctgcccgtggaagtgttcgtatcgcagcca
gatcccgagcagtccaaggaggcagaggagtctcctttgaatgacacctttgacagcaca
gctgaggcacttaccgtaagaagacgtgacacatacgggttgccactggatgatgccaat
gatcagcagcgtcgcaccttcacaattattgagccaacggaatcgaagcgacgcacaatg
accattgcaaagaatgcatcgccggctttggaggccaccgaggcaaacattctgggcgat
gagctggagtccatggatgtagatgtatcaatgagcgtggacactacactctcagcggag
catcaagcgacaaagacgccctcaccatctctgcagcgggagatgcactcgccgcccatg
ccaacacatgagcaggagcagcagccgaaacaagagccgctgcgtccatctccgccgctg
ccggcacatttcaagcgtccgtctatccacaaagagcacatgttagaggagcagacgctc
tccgttaaggagcagctgagcgtgggcgatgaaaaggatgatgtatatgtggatcacttt
ggcgccatgtcacccatcccagatgatatcttcaaggctccccaatttaccagcagcacc
ttcagcagcatggccagaagcaataatcaggcagctgctcctgtttctgctgctgctcct
gctgatgattctactgctgccgcggtccaatttgatgaggccgagtttcacgatggcgcc
agcaacaacaacagcagcaacaatgcgcccatcgatcgcagctcgttgctattaaaattc
gatccgcttctgggtgctccggtgccagtgaatcaacaatcgcagcaggagcaaacgctc
cacaatattctaagcaacatcaacaacaaccacaagaacagcaacaacaaaaacaataac
aattataataatctaacacgtgctttgagtcccacattggaggagcacgattcgagcggc
agcaatcagtccggggaaataacaaaaaagcatgctaaaatgagtgtggacgttattgat
aacgattgtaacaaaaccttcgacaattcaaccctgaactcggaggacaaaacacacaaa
taccacaacatggatgaactggagaagaaaatcaaaaatgaagtcacccgctccgaggac
attgaaaacaaactcaaagaggcagaacagcgcgaagaggcgctcgtcaaacgcattaca
gaaaaggacaaaaacaactcaaagctcaacggcgtcattgaagcctacgagaaagccatt
gcggagctaatccatgacaaggagcagctggtacaaaatcatgagaggcaaatgttggag
gtgcaaacagatcgtgattccaattacacacatttaatgtcgctggaaacgacattttcc
gatctccatgttaaatatgaaaagagcaaggagatgacctcacacctaaagcagatcgag
gaaaatctgctagaggagaagaagaaagtgatggataaattgcgacagcaggagcagcga
tacgagcaaatgaaaagccatgccatgcagcaaatggaaattgcaaacaaaaagttggtc
acccttacaaaagagcacacggatgaggtgaaaaagttgaaagcattactcaaaaaggag
gaagtgtcgcgcatctcgaccgccgagcaactgcagcagaaatcgcgggagaatgccgat
ctgctcaagatatgcgaggagctcatctacgacaagggacaaggaggtagtagttaa

DBGET integrated database retrieval system