KEGG   Drosophila grimshawi: Dgri_GH17575Help
Entry
Dgri_GH17575      CDS       T01061                                 

Definition
GH17575 gene product from transcript GH17575-RA
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1098 aa AA seqDB search
MLKSKSTLNSTASTATATATNAAIALSSNSSSSCASRKPSPALQEAKRRARNMLKAQSTD
PVVDIFQNAMNAKNMQRGATALIYDDSMSEHRCLWDETHQERPERFTRTMERCRELKLVD
RCLQLKSRLATKEEILKLHSMEHYERLEQTSGVQNDEALEELSSHYDAIFIHPSTFKLSL
LASGSTIELVDQLLLGKAQNGMAIIRPPGHHAMKSEFNGYCYFNNVALAAQHAIDAYQLQ
RILIIDYDVHHGQGTQRFFYNDPRVLYFSIHRYEHGSFWPNLPESDFHAIGSGAGTGYNF
NVPLNAKGMGNGDYLAIFQQLLVPVALEFQPELILVSAGYDAALGCPEGEMEVTPACYPH
LLNPLLPLANARIAVILEGGYCVDSLSEGAALTLRALLGDPCPALVEPLLLPSPELRTAL
LNCIYVHRPYWRCLQLQQTYTPGELEQLQHGAMDATDGAQQLHCVQRIWLGGPIQTVPAV
DQRYPTRGTSVQLSATVVASNTARLRLLRTETQLGVPAMRVCYAYDAQMLLHCNLHDVTH
PEQPQRIRQIHQMHTDYQLVERMKPLQPRTATTDEVCLAHTRAHVNTVRRLAGRKPDELQ
QLGADYNSVYLHPSTFDCATLAAGAVLQAVDSVMRGETRSGICNVRPPGHHAESDHPHGF
CIFNNVAIAAQYAIREYQLERILIVDWDVHHGNGTQHIFESNPKVLYISVHRYENGAFFP
KGPDGNYDVCGKNAGCGFNVNIPWNKKGMGDVEYALAFQQLILPIAYEFNPQLVLVSAGF
DAAIGDPLGGCKVTPEGYGLFTHWLSALAGGRIIVCLEGGYNVNSISYAMTMCTKTLLGD
PVPISSTSASSSSSALGSQTVAFQSCVETLQLCVEQQRKHWKSLVFNSKLPQGSTLGEKN
NNEDFLAVALEQLNITSQGDGDASVPAANIHDDGDGGGQQQISASGTKPKVKALEQKELL
TICALKSCPHLSLLRTAEAPKSIRGKKSACGDCESTVENWLCLSCHQIGCGPHTYGHIEQ
HCQRNKHPLALCLGDMSVRCCECNIAKIVEHPQLDAYKNTMASHLDKFDDGDDNANDDND
DDDVESSYCIVHPERNEP
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagtcaaaatcaacgctcaactcaacggcgtcaacggcgacagcgacggcgaca
aatgcagcgattgcgctgagcagcaacagcagcagcagctgcgcttctcgcaaaccgagt
ccagcgcttcaggaggcgaaacgtcgagcgcgcaacatgctgaaagcccagtctacagat
ccagtggtggacatttttcagaatgccatgaatgctaagaatatgcagcgtggggcaaca
gcgctcatctatgatgactcaatgagcgagcatcgctgcctctgggatgaaacgcatcag
gagagacccgagcgctttacgcgcacaatggaacgttgtcgggagctgaaactggtggat
cgttgtctgcagctaaaatcgcgtctggccacaaaggaggagatcctcaagctgcactcg
atggagcattacgaacgcttggagcaaacatctggcgttcaaaatgatgaggcactggag
gaactgagctcccattatgatgcgatctttatacatccgtccacgtttaagctatcgctt
ttggccagcggctcgaccattgagcttgtggatcaactgctgctgggcaaggcacagaac
ggcatggccattatccggccgcctggtcatcatgcgatgaaatcagaatttaatggctat
tgctatttcaataatgttgccttggctgcccagcatgccatcgatgcctatcagctgcag
cgcatcctgatcatcgactacgatgtccatcatggccagggcacacagcgtttcttctac
aatgatcccagggttttgtatttctcgatacatcgttacgagcatggcagcttctggccc
aatttgccagaatcggattttcatgcgattggctctggcgccggcaccggttacaatttc
aatgtgccgctcaatgcgaaaggcatgggcaacggtgattatctggccatcttccagcag
ctgctcgtgcccgtcgcccttgagtttcagccggagctgatacttgtatcggccggctat
gatgcggccttgggttgtcccgagggcgagatggaagtgacgcccgcctgttatccacat
ttactcaatccgttgctgccgttggccaacgcacgcatcgctgtcatcctcgagggtggc
tactgtgtcgactcattgtccgagggtgctgctctcacgctgcgtgctctgctgggcgat
ccgtgtccggcgctggtggagccgctgctattgcccagcccagagttgcgtacggcgctg
ctcaactgcatctacgtgcatcggccgtactggcgctgcctgcagctgcaacagacctat
acacccggcgaattggagcagctgcagcatggcgcaatggatgcaaccgatggagcgcaa
caattgcattgcgttcaacgcatctggctgggcggaccgatacaaacagtgccggccgtc
gatcaacggtatccgacgcgtggcacctccgtccagctgagtgccacagttgtggcaagc
aacacagcacgtctgcgtctgctgcgcaccgaaacgcagctgggtgtgccggcaatgcga
gtgtgttatgcctacgatgcacagatgctgctccattgcaatctgcacgatgtcacacat
ccggagcagccgcagcgcattcgtcagatccatcagatgcacaccgattatcagctggtc
gaacggatgaagccgctgcagccgcgcacagcgacaacggatgaggtgtgcctggcccat
acacgtgcccatgtgaatacggtccgtcgtctggccggacgcaaaccggatgaattgcag
caattgggtgccgattacaattccgtctatctacatccgagtaccttcgattgtgccaca
ctcgccgccggcgccgtactccaggcggtagatagtgttatgcgcggcgagacgcgcagt
ggcatctgcaatgtccgtccgccgggacatcatgccgaatcggatcatccgcatggcttt
tgcatattcaataatgttgcaattgccgcacagtatgcgatacgtgaatatcaattggaa
cgcatcttgatcgttgactgggatgtccatcatggcaatggcacccagcacatcttcgag
tccaatcccaaggtcctctacattagtgtccatcgctacgagaatggcgccttctttccc
aagggacccgatggcaactacgatgtttgtggcaaaaatgccggatgtggcttcaatgtg
aacatcccatggaataagaagggcatgggcgatgtggaatatgcgttggccttccagcag
ctaatcctacccattgcgtacgagtttaatccgcagctggtgttggtttcggctggtttc
gatgcggctatcggtgatccattgggtggttgcaaggtgacaccggagggctatggcctc
ttcacccattggctgtccgcattagctggcggacggatcattgtgtgcctcgagggtggc
tacaatgtcaattccatatcgtatgcgatgaccatgtgcaccaagaccctgctaggtgat
ccagtgccgatctcgtccacatccgcatcatcctcgtcatcagcgctcggctcccaaacg
gttgcgttccagagctgtgtggagacgctgcagctgtgtgtggagcagcagcgcaagcat
tggaagtcgctggtgttcaacagcaaactgccacaaggcagcacgctgggcgagaagaat
aacaatgaggattttcttgctgtcgcattggagcagctaaatatcacgtcgcagggtgat
ggagatgcttccgttcccgctgctaatatccacgatgatggtgatggtggtggccagcag
cagatctcggccagcggcaccaagcccaaagtcaaggcactcgagcaaaaggaattgctt
acaatttgtgcgctcaaaagctgcccacacttgagccttttgcgcacggcggaggctccc
aaatcaataagggggaagaagagcgcgtgcggcgactgcgaatcaacggtggagaattgg
ttgtgtttgagctgtcatcagatcggttgcggtccccacacatacggccacatcgaacag
cattgccaacgcaacaaacatccgttggcgctgtgccttggcgacatgtccgttcggtgt
tgcgagtgcaatatcgccaaaatcgtcgagcatccccagctcgatgcgtataagaacaca
atggcgtcgcatctcgacaagtttgatgacggtgatgataatgctaatgatgacaatgat
gatgatgatgttgagagcagctattgcatagtgcatccggagcggaatgagccatga

DBGET integrated database retrieval system