KEGG   Drosophila grimshawi: Dgri_GH17638Help
Entry
Dgri_GH17638      CDS       T01061                                 

Definition
GH17638 gene product from transcript GH17638-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dgr  Drosophila grimshawi
Brite
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dgri_GH17638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 204 aa AA seqDB search
MGQIVSRKLSETELSAHKAATGLSTKQLEQLHARFLALDRCQSGYLSPTDLLRIPQLAQN
PMHRQIIDGFFTDPSNDRIDFAQFVRTCATFLVPPSGNLRANGRAQKLRLISKMFDTQRT
GHSIERSDFRRVMKYMLDSVPPTDGIAICHPHPESNEMELLQLEELAFGDGIAIVDNQSI
SYEQFELRLDTAVVESKLAISKWL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggccagatagtcagccgcaagctaagcgagacggagctaagcgcacacaaagcagcg
acgggactgtccactaagcaactggagcagctgcatgcccgcttcctggcgctggatcga
tgtcaaagcgggtatttatcgccaacggaccttttgcgcataccgcaattggcacagaat
ccaatgcaccgccagataatcgatggcttcttcacggatccaagcaacgatcgcattgat
tttgctcagtttgtgcgcacctgtgccacgtttctggtgccgccatctggaaatttacgt
gcgaatggacgtgcccagaagctgcgcctaatctccaaaatgtttgatacacagcgaact
ggtcacagcatcgagcgatccgattttcggcgtgtgatgaaatacatgttggacagtgtg
ccgccaacggatgggattgccatatgccatccacatccggagagcaacgaaatggagttg
ctgcaactggaggagctggcgtttggagatggaatagcaatagtggacaaccaaagcatt
tcgtacgagcaatttgagctgcgtctcgacacagccgttgtggaatccaaattggcgatc
agcaagtggttgtag

DBGET integrated database retrieval system