KEGG   Drosophila grimshawi: Dgri_GH17663Help
Entry
Dgri_GH17663      CDS       T01061                                 

Definition
GH17663 gene product from transcript GH17663-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dgr  Drosophila grimshawi
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dgr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 749 aa AA seqDB search
MAASVVKTPNCARKPKELAKTQPAQISDNAAKWRWWVLLLAVFLITFATRYYKVTEPDHI
CWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNETRYQ
GMRYFCTTLGALIMPMGFDTVYDLTRSHEAAVLSAAYLIFDVGMLTLNQYILLDPILLFF
MMGSVWGMVKISKCTTAGGSYTARWWLWLLLTGTMLSCTTSVKFVGLFVVLLVGLHTASE
LWLILGDLSKPIAETLKQIACRALALILWPIVLYTFFFYIHLSVLNRSGNGDGFYSSAFQ
SRLIGNSLYNASMPRDVAYGALVTIKNHKTGGGYLHSHAHLYPKGSGARQQQITTYTHKD
DNNIWQIKPYNKQQLAKDELRLLRHGDLLRLEHLVTKRNLHSHSEPAPMTKKHLQVTGYG
ELGVGDANDVWRVLIVGGRANDTIHTVTSRLMFVHYLQNCALTSSGKQLPKWGFEQQEVS
CNLNIRDKNAHWNVEDNQHKQLPSVSFSIYAPGFFARFLESHAVMLQGNAGLKPKEGEIT
SRPWQWPINYRGQFFSGSSYRIYLLGNPVIWWSNLVFLLLFIAVYLCNAILQHRRAGLAA
QRPTGGATAEQLSTESTTTELCSCCPAMKPTENTLESKPNPDMSLQAAAWLFIGWLLHYL
PFWAMGRVLYFHHYFPALIFNSLLTGIMFNYIIRSLPKWLQHVLLGSVLSTIVYSFVVFS
PLAYGMNGPLANEPNSTMHSLKWLSTWEF
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagtgttgttaagacacccaattgtgcgagaaagcccaaagagttggccaag
acgcagccagcacagataagtgacaatgctgccaagtggcgctggtgggtgctgctgttg
gccgtttttctcatcacctttgccactcgctactataaggtaaccgaaccggatcacatt
tgctgggatgagacgcactttggcaaaatgggcagctggtatataaatcgcaccttcttc
ttcgatgtacatccaccgctgggcaagatgttaattggcttatcgggctatttgacgggc
tacaatggcacctttccgtttgagaaaccgggtgacaaatacaacgagacacgctaccag
ggaatgcgctatttctgcacaacgctgggggcactgataatgccgatgggtttcgacacc
gtctacgatctgacacgctcccacgaggcagcagtgctctcagccgcctatctaatcttt
gatgtgggcatgctgacacttaatcagtacatactactcgatccgatactcttgttcttc
atgatgggctcggtgtggggcatggtcaagatatccaaatgcaccacagctggtggctcg
tatacggcacgctggtggctctggctgctgctcaccggcaccatgctctcctgcacgaca
agcgtgaagtttgtgggtctgtttgtggtgttgctggtgggtctgcacaccgccagcgag
ctctggctcatattgggtgatctgagcaaaccaattgcggagaccctcaaacagattgcg
tgtcgcgccctcgcgctcatcctctggccaattgtgctctacacattcttcttctacata
catctgagcgtgctgaatcgcagtgggaatggcgatggcttctacagctcggcgtttcag
tcacgactcatcggcaattcgctgtacaatgcgagcatgcccagagatgtggcctatggc
gcactggtaaccattaagaatcacaagaccggtggcggctacctccactcgcatgcccat
ctctatcccaagggcagtggcgcccgacagcagcagatcaccacgtatacgcacaaggat
gacaataacatctggcagatcaaaccgtacaacaagcaacagttggccaaggatgagctg
cggctgctgcgacacggagatctgctgagactcgagcatttggtgaccaagcggaatctg
cactcgcacagcgaaccggcgccaatgactaagaagcatctgcaggtcaccggatatggc
gagctgggcgtgggcgatgccaacgatgtgtggcgcgtactcattgtgggcggtcgtgcg
aatgacacaattcacacggtgacctcgcgtctgatgttcgtgcactatctgcagaactgt
gcgctcacgtccagcggcaaacagctgcccaagtggggcttcgagcagcaggaggtctcc
tgcaatctcaacatacgcgacaagaatgcccactggaatgtggaggacaatcagcacaag
caactgcccagtgttagcttcagcatctatgcgccgggcttctttgcgcgcttcctggaa
tcccatgcggtcatgttgcagggcaacgccggcctcaagcccaaagagggcgagatcaca
agccgaccatggcaatggccaattaactatcggggtcaattcttttcgggcagcagctat
cgcatttatttgcttggaaaccccgtcatctggtggagcaacctcgtctttctgctgctc
ttcatcgccgtctacctatgcaatgccatcctgcagcaccgtcgtgctggcctcgctgcc
caaagacccactggaggtgccacggcagagcaactgtccaccgaatcaacaacaactgag
ctgtgcagctgttgtccggcaatgaaaccaactgaaaatacgctcgaatctaagccgaat
cctgacatgtccttgcaggcagctgcttggcttttcatcggctggttgctgcactatttg
cccttctgggcaatgggtcgcgtgctctactttcatcactactttccggcactgatattc
aactcattgctgacgggcattatgttcaactatattatacgatcgctgccaaagtggctg
caacatgtgctcctcggctcagtgctgtcgacgattgtgtatagctttgtggtcttctcg
ccgctggcctacggcatgaatggtccgctggccaatgagcccaattcgacgatgcacagc
ctcaagtggctgtcgacgtgggagttttga

DBGET integrated database retrieval system