KEGG   Drosophila grimshawi: Dgri_GH17693Help
Entry
Dgri_GH17693      CDS       T01061                                 

Definition
GH17693 gene product from transcript GH17693-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dgr  Drosophila grimshawi
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dgri_GH17693
   03008 Ribosome biogenesis in eukaryotes
    Dgri_GH17693
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dgri_GH17693
Ribosome biogenesis [BR:dgr03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dgri_GH17693
Transfer RNA biogenesis [BR:dgr03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dgri_GH17693
Mitochondrial biogenesis [BR:dgr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dgri_GH17693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 193 aa AA seqDB search
MDSNLTERGAKPRTNRNQQQRSSQTTHRVVRKVPPRAANTDGSNIYITSKTDFKAQQKRC
EDLLNSGAKEIYLHCMGYSITRGINLALRLIQNSEGALSYAINTSTIQLVDELHPLCDED
DITFRKRNNSALHIKIYNSSLFDIVVPKLPAQPGYTTTTNKQQQTYRKPQQHHQQRQQHP
QKQQQKLSNPQQK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaatctaaccgagcgaggggccaagccaagaaccaatagaaatcaacagcag
cgcagcagccaaaccacccatcgagttgtgcgaaaggttccgccgcgtgctgccaacacc
gacggaagcaatatttacattacaagcaaaacagactttaaggcacaacagaaacgatgc
gaagatctactgaactcgggtgctaaggagatctatttgcactgcatgggctattccatt
acacgaggtatcaacttggcactgcgtctcatccagaactcggagggggcactcagctac
gcaattaacacgtccaccatacagctggtggatgaactgcatccactttgtgatgaggac
gacataacatttcgcaagcgcaacaattccgccttgcacattaagatctacaatagcagc
ctcttcgatattgtcgtacccaagctgccagcgcagcccggctacacaaccaccaccaat
aaacagcaacagacgtaccgcaagccccagcagcaccaccagcaacgtcagcagcacccg
cagaaacagcagcagaaactaagcaatccacaacaaaagtaa

DBGET integrated database retrieval system