KEGG   Drosophila grimshawi: Dgri_GH17708Help
Entry
Dgri_GH17708      CDS       T01061                                 

Definition
(RefSeq) GH17708 gene product from transcript GH17708-RA
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH17708
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dgri_GH17708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 847 aa AA seqDB search
MRVISPRRSSTSAAGSGSLYGTTSTTGAGSSTGTSSGNSSSGVGATSNGYSRYSSSYYDH
RGGSLSKLLPTSAGGTGTSAAGSSSSSAYNHHSSSSASGYYPSSYSPFSYTPRVSTQRNS
IGSSSYLSGGSGSVLGSGYRNSSSYLSGSNYDTISYGRCGLPRRAKGTTSNGDATTSGTT
TTTTSSISTSTKKDDYATSHRRDAAAAKKLPPSGANGNDYVDATANSSNGSSSKRLSSSC
SSSSLARLVATSALDMYEKYSPANYKPNCELSRSRSAVNEADTDSRNSNSHLSRSNNSND
NSTTCTVTLDRPRNSRYSRLYSSSSDAGGDAAIGASETSSSHLRQRSGSGRFSLSGSNSS
GDVPTATFTLRSNRTRRTAAQDATPTTTTAPTTNGHATDASSNGLDVKLNGLSLLSSSPK
RNAIYDSSSSSSLTPTATTTDTTDDATAAALNHTARNATSSARSVLPPVSPTSSRYWERD
SGRSSTNTTSSSIGTSSLSNKHNSIDDGYKSNRDEKFEGLCGLRNIGNTCFMNSVIQCLS
HTTELTRFLRGHNASPRSATSKDQQILHEFAKLIQEMWTTNVHSVTPMELKRAFSLKHRM
YNDYNQQDAQEFLRFFLDSLHSALNTGVKGETLNIDDNLSDNKKADLTWEWYARHENSLI
RDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLESCLDLFIREEVLDGDEM
PTCSKCKTRRKCTKSFTIQRFPKYLVIHLKRFSETRWSKLSNIVEFPTADRELNMASYGA
NANSNVHYSLYAISNHMGSTAGGHYVAICKHPVSHKWHEFNDNSVSDSIPENCLVSSSAY
ILFYERA
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgatttcgccgcgtagatcgtcaacgtcagcagcgggcagtggcagtctttac
ggcacaacgtcgaccaccggcgctggtagctcgaccggcaccagcagcggcaacagcagc
agcggcgtcggcgccacaagcaacggctactcgcgttactccagctcgtattacgatcat
cgcggcggcagtctatccaaattgctgccgacatcggctggcggcacgggcacatcggca
gctggatcgtcatcatcatctgcatacaatcatcacagcagcagcagcgcgagcggctat
taccccagctcctattccccgttctcgtatacgccgcgggtcagcacacagcgcaatagc
attggctcctcatcgtatctgagcggcggttccggctctgttcttggctctggatatcgg
aatagttcatcgtatttgagcggctctaactatgatacaatttcgtacggccgatgcgga
ttgccgcgtagagcaaagggcacaacatcgaatggcgatgcaaccacatcgggaacaaca
acaacaacaacctcatcaatatcaacatcaacaaagaaagacgattatgccacatcgcat
cgcagagatgctgctgctgcaaaaaagctgccaccaagcggtgctaatggcaatgattat
gttgatgccacagctaacagcagcaacggcagcagctcaaaacgtttgtccagctcatgc
tcatcatcatccctcgcacgtttagttgccacatccgcactggacatgtacgaaaagtac
agtccggccaactataaacccaactgtgaactgtcacgttccagatcggcggtcaatgaa
gccgacaccgatagccgcaacagcaacagccaccttagccgcagcaacaacagcaatgac
aacagcaccacctgcaccgttacattggacaggccgcggaacagccgctacagtcgacta
tatagcagcagcagcgatgccggtggcgatgcggcaataggtgccagcgaaacgtcatca
tcgcatctgaggcagcgcagtggctccggcagattctcgctcagcggcagcaacagcagt
ggcgatgtaccaacggccactttcacgttgcgcagcaatcgaacacgacgcactgcggca
caggatgcgacaccaacaacaacaacagcaccaacgaccaatggtcatgcgacagacgcg
agcagcaatgggctggacgtgaagctcaatggactctcgttgctatcgtcgtcgcccaaa
cgtaatgccatatacgatagcagcagcagcagtagcctgacacccacagcaacaactacg
gacaccacagatgatgcaacggcggcagctttaaatcatacggcacggaatgccacaagt
agcgctcgctccgtgctaccacctgtctcgccaacgtccagccgctattgggaaagggac
agcggacgcagcagcaccaacaccacatcctcttccattggcacatcgtcgctgagcaat
aagcataacagcatcgacgatggctacaagagcaatcgtgacgagaagttcgagggtcta
tgcggtctaagaaatattggaaacacttgcttcatgaactcggttatccaatgcctgagt
cacacgactgaactgacgcgcttcctccgtggacataatgccagcccgcgctcggcgacc
tccaaggatcagcagatactacatgaatttgccaagcttatacaggaaatgtggacgacg
aatgtgcacagcgtgacgccgatggaactgaagcgcgccttttcgttaaagcatcgtatg
tacaacgactacaatcaacaggatgcccaagaatttctacgcttcttccttgactcgttg
cactcggcgcttaatacgggcgtcaaaggtgaaacgcttaacattgatgataatctcagt
gacaataagaaggccgatctgacttgggagtggtatgcacgtcatgagaactctctgata
cgcgacctgtttgttggccagttgaagagcacactgaagtgcacaacgtgtggcaatacc
agcgtaacctttgaccccttctgggacttgagcgtgccactaccttcgtcatcgcgatgc
aaattggagtcgtgcttagatctattcatacgcgaagaggtgctcgatggtgacgagatg
cccacgtgctccaaatgcaagacacgccgaaaatgcaccaaaagcttcacaatacagcgt
ttccccaaatacttggtgatacatctcaaacgcttctcagagacgcgctggagtaagcta
tcgaatattgttgagtttcccacagcggatcgtgagcttaacatggcctcatatggcgcc
aacgcaaattcgaatgtgcattattcgctctatgcgatctccaatcatatgggctcaacg
gctggtggtcattatgtggcaatttgtaagcatccagtctcacacaagtggcatgagttt
aatgacaacagcgtcagcgattctatacctgaaaactgtctcgtttcatccagtgcctat
attttattctacgaacgagcgtaa

DBGET integrated database retrieval system