KEGG   Drosophila grimshawi: Dgri_GH17857Help
Entry
Dgri_GH17857      CDS       T01061                                 

Definition
GH17857 gene product from transcript GH17857-RA
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1148 aa AA seqDB search
MVKKRQTDKRESASSTESGEEELLNGHQHHHHHHSGGGSSSNATVCQHIKKSVDTARLRR
QLKTTGLLFECGQCPKLDANSASSGGDATECEYDNTLWLCLKCGTQLCGRARNQHALQHH
QTPHSDSHALALNTRSFKIWCYNCDSEVSAKSRKNLLECVELVKRLAQKPPKVVPAAANA
AESLPDPRSESVIIHPTMINDIAYKIQTTVEQINTMVNIACGEAIPLPPPLPPPPPQAQA
VPGMAKRPTTTTATSTATSQYRPQVAPVLSSSTQLDRLPRVRGLINLGNTCFFNAVMQCL
AQTPFLLAVLKELAEPGEEFELPGGTFSFKGKGDIELPTIRGTLSSWGNLTAALANALEE
LQSGGGVYTPSKLFDKLCAKCPQFTGGDQHDAHELLRQLLESVRAEDLKRYQRVILQNLG
YKDQDINSVSEELRQKCKIYGNQAADRILRPEQVFRGFLVSTLTCQDCFNVSSRHEYFLD
MSLPVAVEKPQPPQRRKTSPEHSPPTCSKYCNNNNNSGSGVDVIAKFGIGDMDVVFTEHT
SFYLHADGQDQLGPSKAQVKKEKERERKAKRAAKHQRTKLAQKLPVKLNFNDQLSNEASS
SSSNNSGAGDHRHANDEQQQQSGSGDGQVQTPLSSADIDGDKPRSTPWGEGQRADTLSLS
GTTSEHTDADVEDNVAEDSAGPGRGAKFYKDNNGNAQPLGEKHGHGHIEHMDKDSLEEDE
NDSGIATSPAPTTATSTTSNSISNSNSSAISSISNNRSSKNPASSLSVDKKNAAAATPDD
KDNDNDGSTATSLVSAGLSEEGASLIRQLSAGQLQLQLQMEQLTLREQAKSVAGLKRVRT
QSYSDWSTTIAPRYQCEVGECSVPSCLNNFSAVELMTGQNKVGCESCTRRINGTDPQAKS
VNTNATKQLLISSPPAVLILHLKRFQLGPRCVFRKLTRPVTYTMLLDIAAFCGSKVKNLP
NIDRKQKKLLYALYGVVEHSGGLYGGHYTAYVKVRPKVTPDDKRWKFLPHGSKAELDQDD
EQLKKLEESLVKSKAREMRRNAMDDSDDFTSSSSNASTSDEALSDLPQNGINDDEDATAT
STATATASDAADADAAAGDQAPGEPDEAANVQAPPGKWYYVSDSRVQEVSEEAALKAQAY
LLFYERIY
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaacgccaaacggataaacgggaaagcgccagctcaaccgaatctggggag
gaggagctgctaaatggacaccagcatcaccatcatcatcattcgggcggtggatcgtcg
agcaacgcaaccgtttgccagcacatcaagaaatcagtggatacggcgcgattgcgtcgc
caactaaagaccactgggctgctctttgaatgcggacaatgtcccaaactggatgcgaac
agtgcgagcagcggtggcgatgccaccgaatgcgaatacgacaacacgctctggctgtgc
ctcaagtgcggcacacagctgtgcggccgtgcacgcaaccagcacgctctccaacatcat
cagacaccccattcggactcgcatgcgctggccttgaatacgcgctcatttaagatctgg
tgctataactgcgacagcgaggtgagcgccaagtcgcgcaagaatctgctcgagtgcgtc
gagctggtcaagcgacttgcccagaagccgcccaaggttgttcccgccgctgccaatgct
gccgagtcgttgccggacccacgttcagagtcagtaataatacatccgacaatgatcaac
gacattgcatacaaaatccagacgacggtggaacagatcaatacgatggtgaacattgcg
tgcggcgaagcaataccattgccaccaccgttgccaccaccaccgccgcaggcacaggca
gtgcctggcatggccaagcgtccgacgacaacaacagcaacatcaactgcgaccagccaa
tacaggccacaggtagcgccagtgctgtcgtccagcacacagctggaccgtttgccgcgc
gttcgtggtctcatcaatttgggcaacacgtgcttcttcaacgccgtcatgcaatgcctc
gcccagacacccttcctccttgccgttctcaaggagctggccgagccaggcgaagagttt
gagctgcccggcggtactttcagctttaagggcaagggcgacatcgagctgccgaccatc
aggggtactctctcctcgtggggcaatctcactgcggcactggccaatgcgctcgaggag
ctgcagtccggcggcggcgtctatacgcccagcaaactgttcgataagctgtgcgccaag
tgtccccaatttacgggcggagatcagcacgatgcccatgagctgttgcgtcagctgttg
gagagcgtacgcgctgaggatttgaagcgctatcagcgtgtcatcctgcagaatctgggc
tataaggatcaggacattaacagcgtatccgaggagctgcggcaaaagtgcaagatctat
ggcaatcaggcagccgatcgcatcctgcgtccggagcaagtgtttcgcggctttctcgtc
tcgacgctaacgtgccaggactgcttcaatgtgtcgtcacggcacgaatacttcctggac
atgtcgctgcccgtcgccgtcgagaaaccacagccgccgcagcgtcgcaaaactagtccc
gagcattcgccacccacctgcagcaaatactgcaacaacaacaacaacagcggaagcggc
gtggacgtcattgccaagtttggcatcggcgacatggatgtggttttcacagagcacacg
tcgttctatctgcacgccgatggccaggatcagttggggccgtccaaggcccaggtgaag
aaggagaaggagcgcgaacgcaaggcgaagcgtgccgccaaacaccagcgcaccaagctg
gcccaaaagctgcccgtcaaactcaactttaacgatcagctcagcaacgaggccagctcc
agcagcagcaacaacagcggtgccggtgatcatcgtcacgccaatgacgagcagcagcag
cagtccggcagtggtgatggacaagtgcagacgccgctctcctcagcggacatcgatggc
gacaagccacgctcgacgccctggggcgagggtcagcgggcggacacattatcgctgagt
ggcaccacatccgagcatacggatgccgatgtcgaggacaatgtcgctgaggattcggcc
gggcccggacgcggtgccaagttctataaggacaacaacggcaatgcccagccgctgggc
gagaaacatggacatggacacatcgagcacatggacaaggactcgctggaggaggacgag
aacgactcgggcatagccaccagtccggcgccgaccacagccaccagcaccaccagcaac
agcatcagcaacagcaacagcagtgctatcagctccatcagcaacaatcgaagcagcaaa
aatccagctagcagcttgagtgttgataaaaagaatgcagcagcagcaacaccagatgat
aaggataatgacaacgatgggagcacagcgacaagtctggtgagtgctggactgagcgag
gagggtgcatcgctgatacgtcagctgtcagcgggacagctgcagctgcaactacaaatg
gagcagctgacgttgcgcgaacaggccaagtcggtggcaggcttgaagcgagtgcgaacc
caaagctactcggactggagcacaacaatagcgccgcggtatcagtgcgaggttggtgaa
tgctcggtgccatcctgtctgaataactttagtgccgtcgagctgatgaccggtcagaat
aaggtcggctgtgagagctgcacgcgtcgcatcaatggcaccgatccgcaggccaagtcg
gtaaatacgaatgctacaaagcagctgctgatatccagtccaccggcggtgctcatactc
catttgaagagattccagctggggccgcgttgcgtctttcgcaagctgacccgcccggta
acctatacgatgctgctggacattgccgccttctgcggctccaaggtaaagaatttgccc
aacattgatcgcaagcagaagaagttgctctatgcgctctacggcgttgtcgagcactcc
ggcggcctgtacggcggacactataccgcctatgtgaaggtgcgtcccaaggtgacacca
gatgacaagcgatggaaatttctgccgcacggcagcaaggccgaactcgatcaggacgat
gagcagctgaagaagctcgaagagtcgctggtcaaaagcaaggcgcgcgagatgcgcaga
aatgccatggatgacagcgatgactttaccagctccagcagcaatgcatccacctcagac
gaggctctgtccgatctaccacagaatggcattaacgatgatgaagatgcaactgccaca
tccacagccacagcaactgccagtgatgcggctgatgctgatgctgccgccggagatcag
gcgcctggcgaaccagacgaggcggccaatgttcaagcaccgcccggcaaatggtattat
gtatcggactcacgcgtccaggaggtcagcgaggaggcggccctcaaggcacaggcctat
ctgctgttctacgagcgcatctattaa

DBGET integrated database retrieval system