KEGG   Drosophila grimshawi: Dgri_GH18161Help
Entry
Dgri_GH18161      CDS       T01061                                 

Definition
GH18161 gene product from transcript GH18161-RA
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 526 aa AA seqDB search
MESERLCIRLDNPDRIFYAGQVIRGDIWMNLTKRTKIRAIKIQVTGKGKCKWMEILRKNS
NNNEYTRSLFYTSKEIYEHSETPLPEFEPRGLELSPGEHTFTFNVALGHQLPSSFRGSYG
SIKYKMRILIQRPWTFDQRHTIPFTVVKNMPLPATYRSNPTPLEKQITKTISLFGTRPIT
MLALLPEDFAVRGEPLRICVTVVNNSTTNVEKLRFNILQYITYYSHVPLRVQKVECIAIA
NKETGAVAKKSERSFAHELLMPDTAQPTDEEYSGIITISYELRVEAVLRGFFKNLVLNLP
FKVYSQDVSARLGSMRPSLPPRPDDGPPGPDDAAASVAPGNPFEPSAALSVYPALDSSIG
SPSHSSQYSECSSLNSTTSDSTLSPAVGGVELSYTSYTSDSQSSQFGSPSARASLRSNCN
VPYMPYSSSPLMVQSYPPPHLPPYPLPDSPQYTLLALPPLPPPTTATGTSSTAAQAPVGA
GYSQLPSTSAASGSLRQTRQSAGAHALPPSYDELFGNANAPPESPK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcgaacgactctgcattcgactggacaatccagatcgcattttttatgccggc
caagtcatacgcggcgatatttggatgaatctgaccaagcgtaccaaaatacgagctatt
aaaattcaggtaactggcaaaggcaaatgcaaatggatggaaatcctgcgaaagaactcc
aacaacaatgagtacacacgcagcctattctacacgagcaaagagatttacgagcacagc
gaaactccgctcccagaattcgagcctcgcggcctagagttgtcacccggcgagcacaca
ttcaccttcaatgtggcactcggccaccagctgccctccagcttccggggcagctacggc
agcatcaaatacaagatgcgcatcctcattcaacgaccctggacctttgaccagcgacac
acgatcccctttacggttgtaaagaacatgccactgccagcgacctatcgcagcaatccc
acaccgctggagaagcaaattacgaagacaattagcctttttggcacacgaccaatcaca
atgttggccctgctgcccgaggattttgcagtgcgcggcgaaccgttgcgcatctgtgtt
acagttgtcaacaacagcacaaccaatgtggagaaactgcgcttcaacattttgcagtac
atcacctactacagccacgtcccgttgcgtgtgcagaaggtcgagtgcattgcgattgcc
aataaggagacgggcgccgtggcgaagaagagcgaacgcagctttgcccacgagctgctc
atgccggacacggcgcagccgacggacgaggagtacagtggcatcataaccatatcctat
gagctgcgcgttgaggccgtgctgcggggcttcttcaagaatctggtgcttaatttgccg
ttcaaggtctattcgcaggatgtgtccgccaggctgggctcgatgcgaccatcgctgccg
ccccgacccgacgatggaccacctggtccggacgatgccgccgccagcgttgcgccaggc
aatccatttgagccgtcagctgcactgtctgtctatccagcgctagactcttccattggc
tcgccatcgcattcgtcgcagtacagcgaatgcagttccctgaactccaccacatcggac
tccacactgagcccggctgttggtggtgttgagctgtcctacacttcctacacatcggac
tcgcagtcctcgcagtttggcagcccctcggctagggccagcctgcgtagcaactgtaac
gtgccctacatgccttattcgtccagcccactgatggtgcaatcgtatccaccgccacat
ctaccaccgtacccgttgcccgattcgccgcaatatacgctgctcgctctgcctccactc
cccccaccgacaacggcaacgggaacgtcgtcaacggcagcacaggctccagttggtgcc
ggctacagccaattgccatccacctcagcggcgtccggatcgcttaggcagacacgccaa
tccgccggcgcacacgcattgcctccctcgtacgatgagctctttggcaacgccaatgcg
ccgccggagtcaccgaagtga

DBGET integrated database retrieval system