KEGG   Drosophila grimshawi: Dgri_GH18183Help
Entry
Dgri_GH18183      CDS       T01061                                 

Definition
GH18183 gene product from transcript GH18183-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dgri_GH18183
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dgri_GH18183
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dgri_GH18183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 901 aa AA seqDB search
MAQLKKLHMGDRLEDLQKWTIIPNLQKTSMKMLLNTARKLLLTAEDYRLDGDQELAYITY
MKYFNMLSSIRAKSDYNQHKQSVRQMLGDADSNRRIMDTLEQISTSLSKRYNMLLPRSNG
ASISSTLLLPMPPAEPVGETKSIAPAAAQYAQLGVISCETLFQRMQQKSVLVMDCRSSGD
YNHSHLTYYCAFNVPEELISPGMSAGKLQALLSSSDKASWASRSVKESVVLMDWNSKDAQ
STSNTAIVTLLDILKNWDPDVTYRAPIQILEGGYEYFIMMYPTHSTNPSVQAPQQNNNDI
DTIDDIEYPSISDITMKEDILNGSENVPKHKQRPSINRASKPAALRAYDSNHQSNQQPLD
NPINEIMRDQVALLQRAQQNDILLDNAAKKWKSIIELKQLHAEGALLSGSEQEVLYNILQ
LESRADDYKMENDRLRDELDRYKDQQPQQQLQNDAETTRRIEFNIKERQLLDDQHERDRL
ERENQLAVAREAKRHYKPSAETKTTSEDSPESPINDLQQQQQQQHIMPNDEAKGVTRPVY
DRSTKPLDRDVETTATRVRDFSPVVGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLME
FCISDKYRNYISRRNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVD
QQDSHEFLTILMDWLHSDLQTLNVPRQRDVISASEKAWLEFTKSQESLILHLFYGQIKST
VKCITCNKESATYECFSNLSLELPPNANLCYLNQCMDMYFSGEKIHGWNCPNCKTKRDAI
KKLDISKLPPVFYADTSNTGAYIKKQNYLQFPLDNLEMKPYIARAESRTVTPKTYQLYAV
SNHYGSMEGGHYTAFCKSANYGRWYKFDDQIVSPLETSNVVSSAAYILFYTWLPPMQLSL
S
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttaaagaaactgcatatgggcgacaggctggaagatctacagaaatggaca
ataattcccaacttgcaaaagacaagcatgaaaatgttactcaacactgcgcgtaaactg
ctgctgactgccgaggattatcggctggacggcgatcaggaattggcctacattacctat
atgaagtatttcaatatgctgtcatccattcgagccaaatcagattacaaccagcacaag
cagtcggtgcgacaaatgctcggcgacgctgactccaatcgtcgcatcatggacaccctg
gagcagataagcacatcgctgagcaaacgctataatatgctgctgccccgcagcaatggt
gcatcaattagttcgacgctgctcctgccgatgccgccagctgaaccagttggagaaacc
aaatcgattgcgcctgctgctgctcaatatgctcaactgggcgtcattagctgtgagaca
ctgtttcagcggatgcaacagaaatcggtgctggtcatggattgccgcagcagcggcgac
tacaatcactcgcatctgacctactactgtgccttcaatgtgcctgaagagctgatatct
ccggggatgtcagcgggcaaattgcaagcgcttctgagcagcagcgacaaggcttcgtgg
gcatcgcgttccgtaaaggagtcggttgtgttaatggactggaacagcaaagatgcgcag
tcgacgagcaacacagcgattgtcaccctgctggatatactgaaaaattgggatccagat
gtgacttatcgcgcacccatacaaatactggagggcggctacgagtacttcatcatgatg
tacccgacgcactccaccaatcccagcgtgcaagcaccgcagcaaaacaataatgacatc
gacacgatcgatgacattgaatatccatccataagcgatattaccatgaaggaggacatt
ctcaatggaagcgagaacgtgcccaaacacaagcaacgacccagcatcaatcgggccagc
aaacccgccgcactgcgcgcctacgactcgaaccaccaatcaaatcaacagcctcttgac
aatcccatcaatgaaattatgcgagatcaggtagcgttgctgcagcgcgcacagcaaaat
gacatactgttggataacgccgccaagaaatggaagagcatcatcgagctgaagcaattg
cacgccgagggcgcattgctgagcgggtcggagcaggaggtgctctacaatatactccaa
ctggagagcagagccgacgattataaaatggaaaatgaccgtctacgcgacgagctcgat
cgctacaaagaccaacagccacagcagcagctgcaaaatgatgccgaaacgaccaggcgc
attgagttcaatataaaggagcgtcagctgctcgacgatcagcacgagcgcgatcgtctc
gagcgtgagaatcagctggcggttgcacgtgaggcaaagcggcactataagccatcagct
gagacaaagaccacatcggaggattcacccgagagtcccatcaatgatctgcaacagcag
cagcagcaacagcatattatgcccaatgatgaggcaaaaggtgtcacacgtcccgtctac
gatcgatccacgaaaccgctggaccgtgacgtggagacgacagcgacgcgagttcgcgat
ttttcgcccgttgtgggtcaaaatgtgggacgcggcctaacgggcctgaagaatctgggc
aacacttgctatatgaacagcattctccagtgcctgagcaatactccgcagctaatggag
ttttgcatatcggacaaataccgcaactatataagtcgccggaacaaaaccaatggacag
gtcatcgaagaggtcgccgctctcatcaaggaactgtggaatggccaatacaaatgcgtg
gccagtcgagacttgcgctacgttgtgggccagtaccagaaaatctttcgaggcgtcgat
caacaggattcgcatgagtttctcaccatactcatggactggctgcattccgatttacag
actttgaatgtgccgcgtcagcgcgatgtgattagcgcgtcggagaaagcctggctggag
ttcacaaagtcccaggagagtctcatactgcatttattctatggacaaatcaaaagcacc
gtcaagtgtatcacctgcaacaaggagtcggccacatatgagtgtttctcgaatctcagt
ctcgaactgccgcccaatgcaaatctctgctatctgaatcagtgcatggacatgtacttc
agtggcgagaaaattcacggctggaattgtcccaattgcaaaacgaaacgtgatgcaatt
aagaaattggacatttccaaactgcccccagtcttttatgcggatactagcaatacgggt
gcctatattaagaagcaaaactatttacaatttccgctggataatctggaaatgaaacca
tacattgcacgtgcagaatcgcgcaccgtgacacccaaaacataccaactatatgcggtg
tccaatcactacggttccatggagggtgggcattatacggccttttgcaagagcgccaat
tatgggcgctggtataagttcgatgatcaaattgtttcaccgctggaaacgtcaaatgtc
gtctcgagcgccgcctatatactgttctatacatggttaccgccaatgcagctctcattg
tcatag

DBGET integrated database retrieval system