KEGG   Drosophila grimshawi: Dgri_GH18183Help
Entry
Dgri_GH18183      CDS       T01061                                 

Definition
GH18183 gene product from transcript GH18183-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dgr04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 901 aa AA seqDB search
MAQLKKLHMGDRLEDLQKWTIIPNLQKTSMKMLLNTARKLLLTAEDYRLDGDQELAYITY
MKYFNMLSSIRAKSDYNQHKQSVRQMLGDADSNRRIMDTLEQISTSLSKRYNMLLPRSNG
ASISSTLLLPMPPAEPVGETKSIAPAAAQYAQLGVISCETLFQRMQQKSVLVMDCRSSGD
YNHSHLTYYCAFNVPEELISPGMSAGKLQALLSSSDKASWASRSVKESVVLMDWNSKDAQ
STSNTAIVTLLDILKNWDPDVTYRAPIQILEGGYEYFIMMYPTHSTNPSVQAPQQNNNDI
DTIDDIEYPSISDITMKEDILNGSENVPKHKQRPSINRASKPAALRAYDSNHQSNQQPLD
NPINEIMRDQVALLQRAQQNDILLDNAAKKWKSIIELKQLHAEGALLSGSEQEVLYNILQ
LESRADDYKMENDRLRDELDRYKDQQPQQQLQNDAETTRRIEFNIKERQLLDDQHERDRL
ERENQLAVAREAKRHYKPSAETKTTSEDSPESPINDLQQQQQQQHIMPNDEAKGVTRPVY
DRSTKPLDRDVETTATRVRDFSPVVGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLME
FCISDKYRNYISRRNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVD
QQDSHEFLTILMDWLHSDLQTLNVPRQRDVISASEKAWLEFTKSQESLILHLFYGQIKST
VKCITCNKESATYECFSNLSLELPPNANLCYLNQCMDMYFSGEKIHGWNCPNCKTKRDAI
KKLDISKLPPVFYADTSNTGAYIKKQNYLQFPLDNLEMKPYIARAESRTVTPKTYQLYAV
SNHYGSMEGGHYTAFCKSANYGRWYKFDDQIVSPLETSNVVSSAAYILFYTWLPPMQLSL
S
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttaaagaaactgcatatgggcgacaggctggaagatctacagaaatggaca
ataattcccaacttgcaaaagacaagcatgaaaatgttactcaacactgcgcgtaaactg
ctgctgactgccgaggattatcggctggacggcgatcaggaattggcctacattacctat
atgaagtatttcaatatgctgtcatccattcgagccaaatcagattacaaccagcacaag
cagtcggtgcgacaaatgctcggcgacgctgactccaatcgtcgcatcatggacaccctg
gagcagataagcacatcgctgagcaaacgctataatatgctgctgccccgcagcaatggt
gcatcaattagttcgacgctgctcctgccgatgccgccagctgaaccagttggagaaacc
aaatcgattgcgcctgctgctgctcaatatgctcaactgggcgtcattagctgtgagaca
ctgtttcagcggatgcaacagaaatcggtgctggtcatggattgccgcagcagcggcgac
tacaatcactcgcatctgacctactactgtgccttcaatgtgcctgaagagctgatatct
ccggggatgtcagcgggcaaattgcaagcgcttctgagcagcagcgacaaggcttcgtgg
gcatcgcgttccgtaaaggagtcggttgtgttaatggactggaacagcaaagatgcgcag
tcgacgagcaacacagcgattgtcaccctgctggatatactgaaaaattgggatccagat
gtgacttatcgcgcacccatacaaatactggagggcggctacgagtacttcatcatgatg
tacccgacgcactccaccaatcccagcgtgcaagcaccgcagcaaaacaataatgacatc
gacacgatcgatgacattgaatatccatccataagcgatattaccatgaaggaggacatt
ctcaatggaagcgagaacgtgcccaaacacaagcaacgacccagcatcaatcgggccagc
aaacccgccgcactgcgcgcctacgactcgaaccaccaatcaaatcaacagcctcttgac
aatcccatcaatgaaattatgcgagatcaggtagcgttgctgcagcgcgcacagcaaaat
gacatactgttggataacgccgccaagaaatggaagagcatcatcgagctgaagcaattg
cacgccgagggcgcattgctgagcgggtcggagcaggaggtgctctacaatatactccaa
ctggagagcagagccgacgattataaaatggaaaatgaccgtctacgcgacgagctcgat
cgctacaaagaccaacagccacagcagcagctgcaaaatgatgccgaaacgaccaggcgc
attgagttcaatataaaggagcgtcagctgctcgacgatcagcacgagcgcgatcgtctc
gagcgtgagaatcagctggcggttgcacgtgaggcaaagcggcactataagccatcagct
gagacaaagaccacatcggaggattcacccgagagtcccatcaatgatctgcaacagcag
cagcagcaacagcatattatgcccaatgatgaggcaaaaggtgtcacacgtcccgtctac
gatcgatccacgaaaccgctggaccgtgacgtggagacgacagcgacgcgagttcgcgat
ttttcgcccgttgtgggtcaaaatgtgggacgcggcctaacgggcctgaagaatctgggc
aacacttgctatatgaacagcattctccagtgcctgagcaatactccgcagctaatggag
ttttgcatatcggacaaataccgcaactatataagtcgccggaacaaaaccaatggacag
gtcatcgaagaggtcgccgctctcatcaaggaactgtggaatggccaatacaaatgcgtg
gccagtcgagacttgcgctacgttgtgggccagtaccagaaaatctttcgaggcgtcgat
caacaggattcgcatgagtttctcaccatactcatggactggctgcattccgatttacag
actttgaatgtgccgcgtcagcgcgatgtgattagcgcgtcggagaaagcctggctggag
ttcacaaagtcccaggagagtctcatactgcatttattctatggacaaatcaaaagcacc
gtcaagtgtatcacctgcaacaaggagtcggccacatatgagtgtttctcgaatctcagt
ctcgaactgccgcccaatgcaaatctctgctatctgaatcagtgcatggacatgtacttc
agtggcgagaaaattcacggctggaattgtcccaattgcaaaacgaaacgtgatgcaatt
aagaaattggacatttccaaactgcccccagtcttttatgcggatactagcaatacgggt
gcctatattaagaagcaaaactatttacaatttccgctggataatctggaaatgaaacca
tacattgcacgtgcagaatcgcgcaccgtgacacccaaaacataccaactatatgcggtg
tccaatcactacggttccatggagggtgggcattatacggccttttgcaagagcgccaat
tatgggcgctggtataagttcgatgatcaaattgtttcaccgctggaaacgtcaaatgtc
gtctcgagcgccgcctatatactgttctatacatggttaccgccaatgcagctctcattg
tcatag

DBGET integrated database retrieval system