KEGG   Drosophila grimshawi: Dgri_GH18423Help
Entry
Dgri_GH18423      CDS       T01061                                 

Definition
GH18423 gene product from transcript GH18423-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dgr  Drosophila grimshawi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dgr01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dgr01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 339 aa AA seqDB search
MPGQTKAETVEGVQTPMTEQEFKKRDANWVLVLFYIHVYVLGTYAIYVTFTSASWSTILF
TGLISLLGVLGVTVGVHRLWAHRTFTATAPLRVFLMLCQTMAGQGTIYSRVQAHRFHHAK
FLQDEDPYYSKESFVYAQLHGNLLNYSKQQEQMLLNVDMSDIASDRIVMFQKRYYVLLYI
ALNVLLPLNTAFQYFGESVAVSIFVSFWLRSLIVLNVGNLVNSAHFVWSIHKGFKPTDSN
SIFFITKSFWPQYHYMLPHDYQSGEFGDYATGTGSTMIRVFAALDLAKELLTISSVAVRN
GLTIAVDTKRPIVECIEEQRKLQQSAMPENHFLNREKFM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgccaggacaaacaaaggcggagacagtcgaaggcgttcagacgccgatgacggagcag
gagtttaagaagcgtgacgccaactgggtattggtccttttctatatccatgtgtatgtg
ctgggcacgtatgccatttatgtgacattcacgagtgcctcgtggtcaacgatattattc
acgggtctgatcagcctgctgggtgtcctgggcgtgacggtgggcgttcatcggctgtgg
gctcatcgaactttcaccgcaaccgctccgctgcgtgtcttcctcatgctctgccagacg
atggctggccagggcaccatctacagtcgcgtgcaggcgcatcgcttccatcatgccaag
ttcctacaagatgaggatccctactacagcaaagagagcttcgtgtacgcccagttgcat
ggcaatctgctaaattactccaagcagcaggagcagatgttgctcaatgtggacatgtcc
gatattgccagcgatcgcattgtcatgttccaaaagcgctactatgtgctgctttatatt
gcgctgaatgtgctgctgccgttgaacacagccttccagtactttggcgaatcggtggcc
gtctcaatttttgttagcttctggctgcggagtctgattgtattaaatgtgggcaacctg
gtgaattcggctcactttgtgtggagcatacacaagggcttcaagcccaccgattcgaat
agcatattcttcataacaaaatcattttggccacaatatcattatatgctgccccatgac
tatcaaagtggcgagtttggcgactatgcaactggcactggctccaccatgataagggtg
tttgctgccctggatctggccaaagagctgctaaccatctcctccgtggcggtgcgcaat
ggtctgaccatagccgtggacacaaaacggccgattgtcgagtgcattgaggagcagagg
aagctgcagcaaagtgccatgcctgaaaatcattttctcaatcgggaaaagttcatgtga

DBGET integrated database retrieval system